Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0W4ZUH6

Protein Details
Accession A0A0W4ZUH6   
Localization Confidence High
Confidence Score 16.4
NoLS Segment(s)
PositionSequenceProtein Nature
19-61KYLTGFHKRKVERRKKAEEFIKQRKKNERLRMKKENKEKKNILBasic
NLS Segment(s)
PositionSequence
2-8KKKKRKI
16-58ARRKYLTGFHKRKVERRKKAEEFIKQRKKNERLRMKKENKEKK
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR019186  Nucleolar_protein_12  
Gene Ontology GO:0005730  C:nucleolus  
Pfam View protein in Pfam  
PF09805  Nop25  
Amino Acid Sequences MKKKKRKIEIVFDSEARRKYLTGFHKRKVERRKKAEEFIKQRKKNERLRMKKENKEKKNILIQSFVESNCLTQDNTARDFSKSFDIKDEFKKHNVRIFQNKYDDQSCTTVTITEDLS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.56
3 0.47
4 0.38
5 0.3
6 0.28
7 0.33
8 0.38
9 0.44
10 0.49
11 0.54
12 0.62
13 0.67
14 0.74
15 0.77
16 0.78
17 0.77
18 0.79
19 0.83
20 0.8
21 0.84
22 0.83
23 0.82
24 0.81
25 0.82
26 0.83
27 0.78
28 0.79
29 0.8
30 0.8
31 0.79
32 0.79
33 0.79
34 0.79
35 0.83
36 0.86
37 0.86
38 0.85
39 0.86
40 0.86
41 0.82
42 0.8
43 0.74
44 0.68
45 0.68
46 0.64
47 0.55
48 0.48
49 0.41
50 0.35
51 0.33
52 0.28
53 0.21
54 0.16
55 0.15
56 0.12
57 0.13
58 0.1
59 0.09
60 0.14
61 0.15
62 0.17
63 0.2
64 0.2
65 0.2
66 0.2
67 0.21
68 0.25
69 0.24
70 0.22
71 0.25
72 0.28
73 0.31
74 0.39
75 0.45
76 0.4
77 0.47
78 0.53
79 0.52
80 0.56
81 0.59
82 0.59
83 0.62
84 0.67
85 0.67
86 0.67
87 0.65
88 0.64
89 0.59
90 0.53
91 0.46
92 0.41
93 0.34
94 0.29
95 0.26
96 0.22
97 0.2