Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0W4ZHH6

Protein Details
Accession A0A0W4ZHH6   
Localization Confidence Low
Confidence Score 8.7
NoLS Segment(s)
PositionSequenceProtein Nature
8-30QECNNFCKENKKRLKSINFCVENHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 13, cyto_nucl 11, cyto 7, mito 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR007967  GSKIP_dom  
IPR023231  GSKIP_dom_sf  
Pfam View protein in Pfam  
PF05303  GSKIP_dom  
Amino Acid Sequences METSLFIQECNNFCKENKKRLKSINFCVENHTINIVTLEEKEIYIQWTMLGWTILSIAGKSTGFEKKTYESLDTLLKNVSSKFDEQWINDLLEKLLKYENV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.41
3 0.47
4 0.55
5 0.59
6 0.65
7 0.73
8 0.82
9 0.8
10 0.81
11 0.8
12 0.75
13 0.68
14 0.65
15 0.58
16 0.49
17 0.41
18 0.33
19 0.23
20 0.17
21 0.17
22 0.12
23 0.1
24 0.08
25 0.09
26 0.08
27 0.07
28 0.08
29 0.07
30 0.08
31 0.08
32 0.07
33 0.06
34 0.06
35 0.06
36 0.06
37 0.06
38 0.04
39 0.04
40 0.04
41 0.04
42 0.04
43 0.04
44 0.04
45 0.05
46 0.05
47 0.05
48 0.08
49 0.13
50 0.14
51 0.15
52 0.17
53 0.19
54 0.23
55 0.25
56 0.24
57 0.19
58 0.2
59 0.25
60 0.24
61 0.22
62 0.19
63 0.18
64 0.17
65 0.17
66 0.19
67 0.16
68 0.18
69 0.18
70 0.24
71 0.27
72 0.27
73 0.3
74 0.29
75 0.28
76 0.27
77 0.27
78 0.21
79 0.21
80 0.2
81 0.18