Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0W4ZR81

Protein Details
Accession A0A0W4ZR81   
Localization Confidence Low
Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
89-117ILDKEIIKKKEYKKNNKEKIKTNNFLKSQHydrophilic
NLS Segment(s)
PositionSequence
97-103KKEYKKN
Subcellular Location(s) mito 18, mito_nucl 13.666, nucl 7, cyto_nucl 5.666
Family & Domain DBs
InterPro View protein in InterPro  
IPR013870  Ribosomal_L37_mit  
Gene Ontology GO:0005739  C:mitochondrion  
GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
Pfam View protein in Pfam  
PF08561  Ribosomal_L37  
Amino Acid Sequences MTSFRRSLYFNSFFSNKITFKYSRHFLNLTKYILITRGDYRHFSIKTLAPEGTILKGINIYKKGSDPVALKESEYPNWLWKILDEDSSILDKEIIKKKEYKKNNKEKIKTNNFLKSQL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.39
3 0.3
4 0.28
5 0.32
6 0.29
7 0.31
8 0.38
9 0.39
10 0.38
11 0.42
12 0.42
13 0.4
14 0.46
15 0.48
16 0.42
17 0.38
18 0.34
19 0.29
20 0.29
21 0.27
22 0.2
23 0.18
24 0.2
25 0.21
26 0.23
27 0.26
28 0.3
29 0.29
30 0.28
31 0.27
32 0.27
33 0.27
34 0.28
35 0.25
36 0.18
37 0.19
38 0.18
39 0.15
40 0.13
41 0.1
42 0.07
43 0.09
44 0.1
45 0.12
46 0.13
47 0.13
48 0.13
49 0.14
50 0.15
51 0.13
52 0.16
53 0.15
54 0.17
55 0.2
56 0.19
57 0.18
58 0.22
59 0.23
60 0.21
61 0.21
62 0.18
63 0.18
64 0.19
65 0.2
66 0.15
67 0.14
68 0.17
69 0.17
70 0.18
71 0.15
72 0.14
73 0.15
74 0.17
75 0.16
76 0.12
77 0.12
78 0.11
79 0.18
80 0.27
81 0.28
82 0.29
83 0.38
84 0.47
85 0.56
86 0.65
87 0.69
88 0.72
89 0.81
90 0.88
91 0.91
92 0.9
93 0.9
94 0.9
95 0.89
96 0.88
97 0.85
98 0.84