Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0W4ZS35

Protein Details
Accession A0A0W4ZS35    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
21-44VEKQEKPKKACGRARKRILYNRRFBasic
NLS Segment(s)
PositionSequence
23-37KQEKPKKACGRARKR
Subcellular Location(s) mito 20, nucl 4.5, cyto_nucl 3.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MFFADLCVCSAGKVKSQTPKVEKQEKPKKACGRARKRILYNRRFVNVTLSSTGKRKVSILRVLLAIYKGSR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.36
3 0.42
4 0.5
5 0.52
6 0.6
7 0.63
8 0.69
9 0.69
10 0.71
11 0.76
12 0.76
13 0.76
14 0.76
15 0.75
16 0.75
17 0.78
18 0.78
19 0.78
20 0.79
21 0.81
22 0.79
23 0.78
24 0.78
25 0.8
26 0.77
27 0.73
28 0.68
29 0.62
30 0.57
31 0.5
32 0.47
33 0.38
34 0.33
35 0.28
36 0.26
37 0.25
38 0.26
39 0.3
40 0.24
41 0.23
42 0.23
43 0.28
44 0.33
45 0.39
46 0.39
47 0.38
48 0.37
49 0.37
50 0.37
51 0.31