Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

Q6BUB5

Protein Details
Accession Q6BUB5   
Localization Confidence Medium
Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
260-289NSSGRRKLDRKLLKRYKQLKQQGKIPKDFNHydrophilic
NLS Segment(s)
PositionSequence
264-276RRKLDRKLLKRYK
Subcellular Location(s) nucl 15.5, cyto_nucl 10.5, mito 7, cyto 4.5
Family & Domain DBs
KEGG dha:DEHA2C12144g  -  
Amino Acid Sequences MFPRAKIPYRSVRLTAQQASNKGRFFSSKPPKTEDGIYSYSGTHINSHSLSPSSPTMNKHKNKYIPFKDFPKAPESILKQTAEELFSNINMKPTAQMSGATDNFVDFSIPDKYLKSQIKDEVTEKDKALVEELDNFLKSNDQLEQAQSQLNFIKLYYDQDTNSYQPLPEHTLKKSLSGMINLNPSLNDIDDEYLWNLIPKDKTFGSPPFEQSIAKDGFKKWEKVQLQKHKTEIKEEEINNKEFEDFKQLLHNSKTFFKVNSSGRRKLDRKLLKRYKQLKQQGKIPKDFNLIKFNDDNDL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.61
2 0.6
3 0.58
4 0.56
5 0.58
6 0.62
7 0.62
8 0.56
9 0.49
10 0.45
11 0.41
12 0.4
13 0.44
14 0.47
15 0.5
16 0.53
17 0.58
18 0.59
19 0.59
20 0.6
21 0.53
22 0.48
23 0.43
24 0.4
25 0.35
26 0.31
27 0.29
28 0.25
29 0.21
30 0.17
31 0.15
32 0.17
33 0.17
34 0.17
35 0.18
36 0.17
37 0.17
38 0.18
39 0.19
40 0.21
41 0.23
42 0.27
43 0.35
44 0.44
45 0.51
46 0.55
47 0.62
48 0.65
49 0.71
50 0.77
51 0.77
52 0.76
53 0.75
54 0.74
55 0.71
56 0.66
57 0.6
58 0.53
59 0.45
60 0.37
61 0.39
62 0.37
63 0.38
64 0.38
65 0.36
66 0.32
67 0.33
68 0.33
69 0.27
70 0.22
71 0.17
72 0.13
73 0.14
74 0.15
75 0.14
76 0.14
77 0.12
78 0.12
79 0.12
80 0.12
81 0.13
82 0.12
83 0.12
84 0.12
85 0.18
86 0.18
87 0.17
88 0.16
89 0.14
90 0.14
91 0.13
92 0.11
93 0.05
94 0.07
95 0.09
96 0.1
97 0.11
98 0.11
99 0.13
100 0.21
101 0.25
102 0.26
103 0.27
104 0.32
105 0.35
106 0.36
107 0.37
108 0.34
109 0.34
110 0.33
111 0.29
112 0.27
113 0.25
114 0.22
115 0.22
116 0.16
117 0.13
118 0.13
119 0.15
120 0.12
121 0.11
122 0.11
123 0.1
124 0.1
125 0.09
126 0.08
127 0.08
128 0.09
129 0.09
130 0.11
131 0.11
132 0.11
133 0.13
134 0.11
135 0.12
136 0.1
137 0.11
138 0.09
139 0.08
140 0.09
141 0.08
142 0.11
143 0.12
144 0.13
145 0.12
146 0.15
147 0.17
148 0.16
149 0.17
150 0.14
151 0.12
152 0.11
153 0.13
154 0.17
155 0.2
156 0.22
157 0.22
158 0.28
159 0.28
160 0.3
161 0.28
162 0.26
163 0.23
164 0.22
165 0.23
166 0.19
167 0.22
168 0.2
169 0.19
170 0.15
171 0.15
172 0.13
173 0.11
174 0.09
175 0.07
176 0.07
177 0.07
178 0.08
179 0.08
180 0.08
181 0.07
182 0.08
183 0.08
184 0.11
185 0.12
186 0.12
187 0.15
188 0.16
189 0.18
190 0.22
191 0.26
192 0.28
193 0.29
194 0.31
195 0.3
196 0.3
197 0.29
198 0.25
199 0.27
200 0.25
201 0.23
202 0.23
203 0.22
204 0.3
205 0.34
206 0.38
207 0.33
208 0.4
209 0.45
210 0.51
211 0.61
212 0.63
213 0.66
214 0.67
215 0.72
216 0.69
217 0.65
218 0.64
219 0.57
220 0.53
221 0.53
222 0.5
223 0.52
224 0.5
225 0.5
226 0.43
227 0.39
228 0.34
229 0.27
230 0.26
231 0.25
232 0.21
233 0.19
234 0.27
235 0.28
236 0.33
237 0.37
238 0.38
239 0.33
240 0.37
241 0.41
242 0.35
243 0.35
244 0.33
245 0.37
246 0.43
247 0.5
248 0.54
249 0.57
250 0.61
251 0.7
252 0.69
253 0.68
254 0.7
255 0.7
256 0.71
257 0.75
258 0.8
259 0.79
260 0.86
261 0.89
262 0.88
263 0.87
264 0.89
265 0.88
266 0.84
267 0.84
268 0.84
269 0.83
270 0.81
271 0.74
272 0.7
273 0.69
274 0.69
275 0.65
276 0.64
277 0.56
278 0.53
279 0.53