Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0W4ZL15

Protein Details
Accession A0A0W4ZL15   
Localization Confidence Low
Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
93-113LCSLKNPKSIKKIHKNIKVKAHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 15.5, mito_nucl 10.5, cyto 7, nucl 4.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR006073  GTP-bd  
IPR023179  GTP-bd_ortho_bundle_sf  
IPR016478  GTPase_MTG1  
IPR027417  P-loop_NTPase  
Gene Ontology GO:0005743  C:mitochondrial inner membrane  
GO:0005525  F:GTP binding  
Pfam View protein in Pfam  
PF01926  MMR_HSR1  
Amino Acid Sequences MVTFFPRRVYHYQLKASWFPGNMYSGLKDIKSLLNNIDLVIETRDSRVPVSSQNKLVEEIIKNKEKIIIFNKHDLSGTYYDKVFQDFYKDGILCSLKNPKSIKKIHKNIKVKALELNQASGMNIMVLGMPNVGKSTLLNSFRCIGMLSKNTGRKTRKVAKTGAQPGITKKVTQKIKIMENPLVYCMDTPGIMIPSIKDPITFIKLALVGSIKDNILDNVILADYLLFRLNLIDPKLYLIPFKMSQPTNNVEELLNAIAIGTGRLQKGGIPNIHAAAAFFINKYRLGNLGKFILDDIPKKK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.63
2 0.61
3 0.59
4 0.54
5 0.46
6 0.39
7 0.34
8 0.32
9 0.27
10 0.25
11 0.23
12 0.21
13 0.22
14 0.2
15 0.18
16 0.18
17 0.22
18 0.22
19 0.24
20 0.23
21 0.24
22 0.25
23 0.24
24 0.22
25 0.17
26 0.16
27 0.15
28 0.14
29 0.11
30 0.13
31 0.15
32 0.15
33 0.15
34 0.16
35 0.16
36 0.24
37 0.3
38 0.33
39 0.37
40 0.4
41 0.4
42 0.39
43 0.39
44 0.36
45 0.33
46 0.35
47 0.37
48 0.39
49 0.38
50 0.37
51 0.41
52 0.36
53 0.39
54 0.4
55 0.42
56 0.4
57 0.48
58 0.49
59 0.44
60 0.43
61 0.38
62 0.34
63 0.29
64 0.28
65 0.22
66 0.21
67 0.22
68 0.22
69 0.22
70 0.19
71 0.14
72 0.17
73 0.16
74 0.17
75 0.21
76 0.2
77 0.19
78 0.21
79 0.22
80 0.17
81 0.2
82 0.28
83 0.24
84 0.31
85 0.34
86 0.36
87 0.44
88 0.53
89 0.6
90 0.61
91 0.7
92 0.74
93 0.81
94 0.83
95 0.79
96 0.8
97 0.71
98 0.62
99 0.58
100 0.51
101 0.46
102 0.38
103 0.34
104 0.25
105 0.22
106 0.21
107 0.15
108 0.11
109 0.06
110 0.05
111 0.04
112 0.03
113 0.03
114 0.03
115 0.03
116 0.03
117 0.03
118 0.04
119 0.04
120 0.04
121 0.04
122 0.06
123 0.12
124 0.16
125 0.16
126 0.17
127 0.19
128 0.18
129 0.19
130 0.17
131 0.12
132 0.12
133 0.14
134 0.16
135 0.2
136 0.25
137 0.27
138 0.34
139 0.36
140 0.36
141 0.43
142 0.5
143 0.53
144 0.52
145 0.55
146 0.53
147 0.59
148 0.62
149 0.58
150 0.5
151 0.44
152 0.41
153 0.44
154 0.39
155 0.31
156 0.27
157 0.3
158 0.33
159 0.35
160 0.38
161 0.35
162 0.42
163 0.45
164 0.46
165 0.42
166 0.39
167 0.37
168 0.33
169 0.28
170 0.21
171 0.16
172 0.13
173 0.1
174 0.07
175 0.07
176 0.06
177 0.06
178 0.07
179 0.07
180 0.07
181 0.09
182 0.1
183 0.1
184 0.09
185 0.1
186 0.13
187 0.16
188 0.16
189 0.14
190 0.14
191 0.15
192 0.15
193 0.15
194 0.12
195 0.09
196 0.1
197 0.12
198 0.09
199 0.09
200 0.1
201 0.09
202 0.09
203 0.09
204 0.07
205 0.06
206 0.06
207 0.06
208 0.05
209 0.05
210 0.04
211 0.05
212 0.06
213 0.05
214 0.05
215 0.06
216 0.09
217 0.12
218 0.14
219 0.14
220 0.13
221 0.16
222 0.18
223 0.18
224 0.17
225 0.15
226 0.18
227 0.18
228 0.21
229 0.25
230 0.25
231 0.28
232 0.32
233 0.35
234 0.34
235 0.33
236 0.31
237 0.25
238 0.23
239 0.22
240 0.17
241 0.12
242 0.09
243 0.07
244 0.07
245 0.07
246 0.07
247 0.07
248 0.1
249 0.1
250 0.11
251 0.11
252 0.13
253 0.19
254 0.26
255 0.27
256 0.27
257 0.28
258 0.29
259 0.3
260 0.27
261 0.21
262 0.16
263 0.16
264 0.13
265 0.12
266 0.13
267 0.14
268 0.16
269 0.17
270 0.17
271 0.21
272 0.25
273 0.28
274 0.29
275 0.32
276 0.3
277 0.29
278 0.29
279 0.29
280 0.28