FuNGI

A0A0C3BUX4

Protein Details

Accession

A0A0C3BUX4

Localization Confidence

Low

Confidence Score

6.5

NoLS Segment(s)

Position	Sequence	Protein Nature
492-516	VTPQEREREKQKGDWRQRRKGVGAA	Hydrophilic

NLS Segment(s)

Subcellular Location(s)

mito 9, cyto 7, mito_nucl 7, nucl 5, plas 5

Family & Domain DBs

InterPro	View protein in InterPro IPR042859 NOL11
Gene Ontology	GO:0005730 C:nucleolus GO:0030490 P:maturation of SSU-rRNA

Amino Acid Sequences

MSSSNINDPFVLASYTSSFRGKTHQKYTPGVYASSYKRPNKTNEFVSVAVQADGLHVLDLSGFSFLSTSSKYPVSLLALTSSHVLLAAVASQEINLLLWDMQFSVLLSSHTLAVPSALSSSQLHIRLLPGSQTPTKNQTHVAGQAILIVSSMPTPDSPTKSTSVLLVVPYSVPTTSTIAAAMGRGGAGKKWIRASEERTSSESEQLSAEEMARVNVLATMRTAMQGGRPQAAVAAFMKWAPQNDEVCLLITKGRIVQLLTRQTLFNIFSSGVPCVARWYKCLKSIELAFSTVLDISESELMETLQTVVSRHRETPATAARDAMDVDSPPSSSGDAVPSLPIFLQHVASYPTSRGPLVLAFRTYMKEPEDLMAVLQVLNTWLVRRSKMDERLLPTKKDLRKTEQCVWVVVGRKGDKDKKEDIPSLEKITEILQIILDASFLTLLQHQPSHKIIRSLSAILRPEIAFANTIEGLRGFSEPFALAQDKAVKESLVTPQEREREKQKGDWRQRRKGVGAAPGVGADIGVYKLEELVL

FASTA Sequence
with NoLS information

AlphaFold Structure
with highlighted NoLS

NoLS Predictions per Residue

Residue Number	Score
1	0.14
2	0.17
3	0.19
4	0.2
5	0.19
6	0.2
7	0.29
8	0.37
9	0.43
10	0.5
11	0.56
12	0.6
13	0.65
14	0.7
15	0.68
16	0.61
17	0.53
18	0.46
19	0.46
20	0.44
21	0.48
22	0.51
23	0.51
24	0.55
25	0.61
26	0.67
27	0.69
28	0.71
29	0.68
30	0.65
31	0.63
32	0.57
33	0.53
34	0.46
35	0.38
36	0.3
37	0.24
38	0.17
39	0.13
40	0.12
41	0.1
42	0.07
43	0.06
44	0.05
45	0.05
46	0.06
47	0.05
48	0.05
49	0.05
50	0.05
51	0.05
52	0.06
53	0.08
54	0.1
55	0.11
56	0.14
57	0.15
58	0.16
59	0.16
60	0.19
61	0.2
62	0.19
63	0.18
64	0.18
65	0.17
66	0.17
67	0.18
68	0.15
69	0.11
70	0.1
71	0.09
72	0.06
73	0.06
74	0.06
75	0.05
76	0.06
77	0.06
78	0.05
79	0.06
80	0.06
81	0.06
82	0.04
83	0.05
84	0.05
85	0.05
86	0.06
87	0.06
88	0.06
89	0.06
90	0.06
91	0.06
92	0.07
93	0.07
94	0.08
95	0.08
96	0.09
97	0.09
98	0.09
99	0.08
100	0.08
101	0.08
102	0.07
103	0.07
104	0.06
105	0.08
106	0.09
107	0.11
108	0.16
109	0.17
110	0.17
111	0.17
112	0.18
113	0.18
114	0.18
115	0.17
116	0.15
117	0.18
118	0.23
119	0.25
120	0.27
121	0.33
122	0.35
123	0.34
124	0.35
125	0.33
126	0.31
127	0.31
128	0.3
129	0.23
130	0.21
131	0.21
132	0.18
133	0.15
134	0.12
135	0.08
136	0.06
137	0.06
138	0.06
139	0.04
140	0.04
141	0.09
142	0.13
143	0.17
144	0.19
145	0.22
146	0.24
147	0.25
148	0.25
149	0.22
150	0.2
151	0.17
152	0.15
153	0.13
154	0.11
155	0.1
156	0.1
157	0.1
158	0.08
159	0.07
160	0.08
161	0.1
162	0.1
163	0.1
164	0.1
165	0.09
166	0.09
167	0.09
168	0.07
169	0.05
170	0.04
171	0.05
172	0.05
173	0.05
174	0.1
175	0.12
176	0.15
177	0.18
178	0.2
179	0.24
180	0.28
181	0.34
182	0.37
183	0.41
184	0.41
185	0.4
186	0.42
187	0.39
188	0.39
189	0.32
190	0.25
191	0.19
192	0.17
193	0.16
194	0.12
195	0.11
196	0.08
197	0.08
198	0.07
199	0.07
200	0.07
201	0.06
202	0.07
203	0.07
204	0.06
205	0.06
206	0.06
207	0.07
208	0.07
209	0.07
210	0.06
211	0.08
212	0.12
213	0.13
214	0.13
215	0.13
216	0.13
217	0.13
218	0.13
219	0.12
220	0.09
221	0.08
222	0.07
223	0.07
224	0.09
225	0.08
226	0.09
227	0.11
228	0.15
229	0.15
230	0.15
231	0.17
232	0.16
233	0.15
234	0.15
235	0.12
236	0.09
237	0.08
238	0.08
239	0.08
240	0.08
241	0.08
242	0.09
243	0.11
244	0.16
245	0.21
246	0.22
247	0.22
248	0.21
249	0.2
250	0.22
251	0.2
252	0.14
253	0.1
254	0.1
255	0.09
256	0.1
257	0.1
258	0.09
259	0.08
260	0.08
261	0.11
262	0.14
263	0.14
264	0.16
265	0.21
266	0.23
267	0.29
268	0.31
269	0.28
270	0.28
271	0.3
272	0.31
273	0.26
274	0.24
275	0.18
276	0.16
277	0.16
278	0.12
279	0.09
280	0.06
281	0.05
282	0.05
283	0.06
284	0.06
285	0.05
286	0.05
287	0.05
288	0.05
289	0.05
290	0.05
291	0.04
292	0.05
293	0.05
294	0.08
295	0.12
296	0.14
297	0.15
298	0.17
299	0.18
300	0.18
301	0.24
302	0.28
303	0.28
304	0.26
305	0.26
306	0.24
307	0.23
308	0.23
309	0.17
310	0.11
311	0.07
312	0.08
313	0.08
314	0.07
315	0.07
316	0.08
317	0.07
318	0.07
319	0.07
320	0.08
321	0.08
322	0.08
323	0.08
324	0.08
325	0.08
326	0.07
327	0.07
328	0.07
329	0.07
330	0.08
331	0.07
332	0.08
333	0.1
334	0.11
335	0.12
336	0.11
337	0.12
338	0.13
339	0.13
340	0.12
341	0.1
342	0.13
343	0.15
344	0.16
345	0.15
346	0.15
347	0.16
348	0.18
349	0.18
350	0.17
351	0.16
352	0.16
353	0.16
354	0.15
355	0.16
356	0.14
357	0.13
358	0.11
359	0.09
360	0.08
361	0.07
362	0.06
363	0.05
364	0.05
365	0.05
366	0.05
367	0.1
368	0.12
369	0.14
370	0.16
371	0.22
372	0.3
373	0.38
374	0.44
375	0.45
376	0.49
377	0.58
378	0.6
379	0.56
380	0.54
381	0.54
382	0.54
383	0.57
384	0.57
385	0.56
386	0.62
387	0.67
388	0.7
389	0.7
390	0.65
391	0.57
392	0.53
393	0.48
394	0.43
395	0.37
396	0.35
397	0.29
398	0.32
399	0.38
400	0.44
401	0.45
402	0.47
403	0.51
404	0.53
405	0.58
406	0.6
407	0.57
408	0.56
409	0.54
410	0.53
411	0.46
412	0.38
413	0.31
414	0.27
415	0.25
416	0.19
417	0.15
418	0.11
419	0.1
420	0.11
421	0.1
422	0.09
423	0.05
424	0.05
425	0.04
426	0.04
427	0.05
428	0.07
429	0.08
430	0.11
431	0.14
432	0.15
433	0.2
434	0.25
435	0.31
436	0.32
437	0.35
438	0.34
439	0.36
440	0.39
441	0.39
442	0.38
443	0.37
444	0.36
445	0.32
446	0.35
447	0.29
448	0.26
449	0.24
450	0.21
451	0.16
452	0.14
453	0.17
454	0.15
455	0.15
456	0.14
457	0.12
458	0.13
459	0.12
460	0.13
461	0.1
462	0.09
463	0.11
464	0.1
465	0.11
466	0.14
467	0.14
468	0.13
469	0.17
470	0.24
471	0.23
472	0.25
473	0.25
474	0.21
475	0.2
476	0.24
477	0.28
478	0.29
479	0.3
480	0.31
481	0.37
482	0.45
483	0.49
484	0.5
485	0.5
486	0.51
487	0.55
488	0.61
489	0.64
490	0.67
491	0.75
492	0.81
493	0.83
494	0.84
495	0.88
496	0.87
497	0.81
498	0.77
499	0.73
500	0.71
501	0.65
502	0.56
503	0.48
504	0.4
505	0.35
506	0.27
507	0.2
508	0.11
509	0.08
510	0.06
511	0.06
512	0.06
513	0.06

A0A0C3BUX4

3D AlphaFold-predicted Structure Viewer