Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2XHA8

Protein Details
Accession A0A0C2XHA8    Localization Confidence Low Confidence Score 8
NoLS Segment(s)
PositionSequenceProtein Nature
93-112FLRLARLGRRRGRHERHPLEBasic
NLS Segment(s)
PositionSequence
100-105GRRRGR
Subcellular Location(s) mito 9, cyto 8, mito_nucl 8
Family & Domain DBs
Amino Acid Sequences MASLTHGVLNIGNHVQIRLEKHQHRSLRSLKVRLVLEAPLDIPFDIFRRWYPPSRTKLTINAGNTTSLAIGEIRPDEIANGGWDTIEKQLLHFLRLARLGRRRGRHERHPLELAVSMRLHR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.13
2 0.14
3 0.15
4 0.21
5 0.26
6 0.34
7 0.39
8 0.46
9 0.54
10 0.58
11 0.59
12 0.62
13 0.62
14 0.63
15 0.64
16 0.62
17 0.56
18 0.57
19 0.54
20 0.47
21 0.41
22 0.31
23 0.24
24 0.2
25 0.17
26 0.11
27 0.11
28 0.09
29 0.08
30 0.07
31 0.08
32 0.08
33 0.08
34 0.08
35 0.12
36 0.16
37 0.22
38 0.29
39 0.36
40 0.42
41 0.47
42 0.49
43 0.47
44 0.49
45 0.48
46 0.45
47 0.39
48 0.35
49 0.3
50 0.27
51 0.24
52 0.19
53 0.13
54 0.08
55 0.07
56 0.05
57 0.04
58 0.05
59 0.05
60 0.05
61 0.06
62 0.06
63 0.05
64 0.06
65 0.06
66 0.06
67 0.06
68 0.06
69 0.06
70 0.06
71 0.07
72 0.08
73 0.1
74 0.09
75 0.09
76 0.17
77 0.17
78 0.19
79 0.2
80 0.2
81 0.2
82 0.26
83 0.28
84 0.29
85 0.36
86 0.44
87 0.49
88 0.57
89 0.62
90 0.68
91 0.74
92 0.77
93 0.81
94 0.79
95 0.78
96 0.75
97 0.66
98 0.58
99 0.54
100 0.45
101 0.37