Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3CVH8

Protein Details
Accession A0A0C3CVH8    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
261-280RQHLSNRKSSKTRRATRGMEHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 12, extr 6, E.R. 5, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009617  Seipin  
Gene Ontology GO:0005789  C:endoplasmic reticulum membrane  
GO:0140042  P:lipid droplet formation  
GO:0006629  P:lipid metabolic process  
Pfam View protein in Pfam  
PF06775  Seipin  
Amino Acid Sequences MARRVLSPVLGAVLSAVRPFAPRLVPILVCALFVPLVLLLSASAGWFVWSSLSASWEVPLYLQYGDGIPPYAYVQLPTLIPQQRYHVSLDLLLPNTDSNAQLGNFMVNLTVSTLNNKTLAHFVPKAFALPPKSSLFFSSPISSHLRVPLLEHFTSGKATLAANVQVGRRDAWTSLGAGQGREVNVIAASLRGLAVPHGIRGIAIRFPLLSSLTAAGTFFLILSLILGMCILPLLLSNIPEYPEETEIKDESRPTESPASGRQHLSNRKSSKTRRATRGMEEIKSEAPVQTLPTSDDPTRGLRRRSSKPTIAASEEET
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.1
2 0.09
3 0.09
4 0.08
5 0.09
6 0.11
7 0.14
8 0.15
9 0.16
10 0.2
11 0.23
12 0.23
13 0.23
14 0.27
15 0.23
16 0.21
17 0.2
18 0.17
19 0.12
20 0.12
21 0.11
22 0.06
23 0.06
24 0.05
25 0.05
26 0.04
27 0.05
28 0.05
29 0.04
30 0.04
31 0.04
32 0.05
33 0.05
34 0.05
35 0.05
36 0.06
37 0.07
38 0.08
39 0.1
40 0.1
41 0.1
42 0.11
43 0.11
44 0.1
45 0.09
46 0.09
47 0.09
48 0.08
49 0.08
50 0.08
51 0.08
52 0.08
53 0.08
54 0.09
55 0.07
56 0.08
57 0.09
58 0.1
59 0.09
60 0.1
61 0.1
62 0.11
63 0.11
64 0.12
65 0.19
66 0.22
67 0.23
68 0.24
69 0.28
70 0.29
71 0.31
72 0.32
73 0.26
74 0.22
75 0.22
76 0.23
77 0.22
78 0.2
79 0.18
80 0.16
81 0.13
82 0.14
83 0.13
84 0.11
85 0.08
86 0.08
87 0.09
88 0.09
89 0.09
90 0.08
91 0.07
92 0.07
93 0.06
94 0.05
95 0.05
96 0.06
97 0.07
98 0.07
99 0.1
100 0.11
101 0.12
102 0.13
103 0.13
104 0.13
105 0.14
106 0.16
107 0.17
108 0.19
109 0.18
110 0.19
111 0.19
112 0.19
113 0.16
114 0.19
115 0.18
116 0.17
117 0.21
118 0.21
119 0.22
120 0.22
121 0.23
122 0.21
123 0.19
124 0.2
125 0.18
126 0.16
127 0.18
128 0.21
129 0.2
130 0.19
131 0.19
132 0.18
133 0.16
134 0.18
135 0.19
136 0.2
137 0.19
138 0.18
139 0.17
140 0.16
141 0.17
142 0.15
143 0.11
144 0.07
145 0.07
146 0.07
147 0.07
148 0.07
149 0.08
150 0.09
151 0.09
152 0.1
153 0.11
154 0.1
155 0.1
156 0.1
157 0.1
158 0.1
159 0.11
160 0.1
161 0.1
162 0.13
163 0.12
164 0.11
165 0.12
166 0.11
167 0.11
168 0.1
169 0.09
170 0.06
171 0.06
172 0.06
173 0.05
174 0.04
175 0.04
176 0.03
177 0.04
178 0.03
179 0.04
180 0.04
181 0.07
182 0.07
183 0.07
184 0.07
185 0.07
186 0.07
187 0.08
188 0.09
189 0.08
190 0.08
191 0.08
192 0.08
193 0.08
194 0.09
195 0.09
196 0.08
197 0.07
198 0.08
199 0.08
200 0.08
201 0.08
202 0.07
203 0.06
204 0.06
205 0.05
206 0.04
207 0.04
208 0.03
209 0.03
210 0.03
211 0.03
212 0.03
213 0.03
214 0.03
215 0.03
216 0.03
217 0.02
218 0.02
219 0.02
220 0.05
221 0.06
222 0.07
223 0.08
224 0.09
225 0.1
226 0.11
227 0.12
228 0.12
229 0.14
230 0.15
231 0.15
232 0.17
233 0.17
234 0.18
235 0.19
236 0.18
237 0.18
238 0.22
239 0.21
240 0.23
241 0.28
242 0.27
243 0.28
244 0.35
245 0.39
246 0.38
247 0.39
248 0.4
249 0.44
250 0.53
251 0.55
252 0.58
253 0.57
254 0.61
255 0.68
256 0.72
257 0.74
258 0.75
259 0.79
260 0.78
261 0.82
262 0.8
263 0.77
264 0.79
265 0.74
266 0.66
267 0.59
268 0.52
269 0.44
270 0.4
271 0.34
272 0.24
273 0.19
274 0.17
275 0.17
276 0.16
277 0.16
278 0.18
279 0.21
280 0.26
281 0.25
282 0.27
283 0.26
284 0.32
285 0.41
286 0.44
287 0.47
288 0.51
289 0.59
290 0.66
291 0.73
292 0.75
293 0.73
294 0.74
295 0.76
296 0.73
297 0.68