Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3CRZ0

Protein Details
Accession A0A0C3CRZ0    Localization Confidence Low Confidence Score 9.7
NoLS Segment(s)
PositionSequenceProtein Nature
50-80TWHFPHFRGRSGKRKRRTKTRMREGRQGGPWBasic
NLS Segment(s)
PositionSequence
57-76RGRSGKRKRRTKTRMREGRQ
Subcellular Location(s) mito 16.5, cyto_mito 10, nucl 6, cyto 2.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR045075  Syf1-like  
Gene Ontology GO:0005634  C:nucleus  
GO:0000398  P:mRNA splicing, via spliceosome  
Amino Acid Sequences MFAKFEVRRLELPAVLKILGTAIGMCPKEALFKRYIDLEVELREFDRARTWHFPHFRGRSGKRKRRTKTRMREGRQGGPWRSNNCPREGL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.28
2 0.24
3 0.22
4 0.17
5 0.14
6 0.11
7 0.09
8 0.06
9 0.06
10 0.1
11 0.11
12 0.11
13 0.11
14 0.1
15 0.17
16 0.18
17 0.21
18 0.19
19 0.19
20 0.21
21 0.22
22 0.23
23 0.17
24 0.17
25 0.15
26 0.14
27 0.14
28 0.13
29 0.11
30 0.12
31 0.11
32 0.09
33 0.12
34 0.11
35 0.16
36 0.22
37 0.25
38 0.32
39 0.36
40 0.38
41 0.43
42 0.47
43 0.48
44 0.51
45 0.55
46 0.58
47 0.66
48 0.73
49 0.74
50 0.8
51 0.83
52 0.85
53 0.89
54 0.89
55 0.89
56 0.91
57 0.92
58 0.88
59 0.89
60 0.84
61 0.82
62 0.8
63 0.77
64 0.71
65 0.69
66 0.69
67 0.64
68 0.66
69 0.67
70 0.63