Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2XV37

Protein Details
Accession A0A0C2XV37   
Localization Confidence Low
Confidence Score 8.8
NoLS Segment(s)
PositionSequenceProtein Nature
2-30PTATVSQTSQKQKKEKDKERTSSQPQPNEHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14, cyto_nucl 10.5, mito 9, cyto 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR012677  Nucleotide-bd_a/b_plait_sf  
IPR035979  RBD_domain_sf  
IPR039722  Upf3  
IPR005120  UPF3_dom  
Gene Ontology GO:0003676  F:nucleic acid binding  
GO:0000184  P:nuclear-transcribed mRNA catabolic process, nonsense-mediated decay  
Pfam View protein in Pfam  
PF03467  Smg4_UPF3  
CDD cd12455  RRM_like_Smg4_UPF3  
Amino Acid Sequences MPTATVSQTSQKQKKEKDKERTSSQPQPNERLKTVVRRLPPNLPEEVFWQSVQPWVTEDTAVWKVFYPGKLRKKLNKENIPSRAYIAFKNEEQLASFSRGYDGHIFRDKTGVIITDESLCPLTWSRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.76
2 0.81
3 0.83
4 0.84
5 0.87
6 0.87
7 0.87
8 0.87
9 0.85
10 0.84
11 0.81
12 0.79
13 0.74
14 0.74
15 0.73
16 0.68
17 0.61
18 0.56
19 0.51
20 0.51
21 0.54
22 0.51
23 0.48
24 0.49
25 0.52
26 0.54
27 0.54
28 0.47
29 0.43
30 0.38
31 0.33
32 0.3
33 0.3
34 0.24
35 0.2
36 0.18
37 0.15
38 0.17
39 0.16
40 0.13
41 0.1
42 0.11
43 0.11
44 0.11
45 0.1
46 0.11
47 0.14
48 0.14
49 0.13
50 0.11
51 0.13
52 0.15
53 0.17
54 0.19
55 0.25
56 0.34
57 0.41
58 0.47
59 0.54
60 0.62
61 0.7
62 0.74
63 0.75
64 0.74
65 0.75
66 0.77
67 0.71
68 0.61
69 0.54
70 0.47
71 0.39
72 0.33
73 0.28
74 0.24
75 0.22
76 0.24
77 0.22
78 0.19
79 0.19
80 0.19
81 0.17
82 0.18
83 0.18
84 0.15
85 0.16
86 0.16
87 0.18
88 0.23
89 0.22
90 0.24
91 0.31
92 0.32
93 0.31
94 0.34
95 0.31
96 0.25
97 0.25
98 0.21
99 0.16
100 0.16
101 0.17
102 0.17
103 0.17
104 0.17
105 0.17
106 0.15
107 0.15