Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3CLE3

Protein Details
Accession A0A0C3CLE3    Localization Confidence Medium Confidence Score 13.7
NoLS Segment(s)
PositionSequenceProtein Nature
1-40MTTKSTRSSMPKKNSRASPTSSRAPPKTWKPKRNTPLPFLHydrophilic
62-83LPLPCTAQKKKKSPRSPPCICIHydrophilic
NLS Segment(s)
PositionSequence
22-32SRAPPKTWKPK
Subcellular Location(s) nucl 14, cyto_nucl 11, mito 9, cyto 4
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MTTKSTRSSMPKKNSRASPTSSRAPPKTWKPKRNTPLPFLAHPTFVSQLYITFPCLHCVSILPLPCTAQKKKKSPRSPPCICISYTLQKLITVTLPVFLFSYFEKHISFLITYLYL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.81
2 0.78
3 0.74
4 0.71
5 0.7
6 0.66
7 0.66
8 0.64
9 0.64
10 0.6
11 0.59
12 0.61
13 0.62
14 0.67
15 0.7
16 0.72
17 0.72
18 0.8
19 0.83
20 0.85
21 0.81
22 0.75
23 0.74
24 0.68
25 0.62
26 0.58
27 0.5
28 0.41
29 0.35
30 0.31
31 0.24
32 0.19
33 0.18
34 0.11
35 0.1
36 0.11
37 0.11
38 0.11
39 0.11
40 0.11
41 0.13
42 0.13
43 0.13
44 0.11
45 0.11
46 0.12
47 0.13
48 0.15
49 0.13
50 0.13
51 0.14
52 0.17
53 0.22
54 0.25
55 0.31
56 0.38
57 0.47
58 0.57
59 0.67
60 0.74
61 0.8
62 0.85
63 0.86
64 0.85
65 0.8
66 0.76
67 0.68
68 0.58
69 0.51
70 0.46
71 0.44
72 0.39
73 0.37
74 0.31
75 0.29
76 0.29
77 0.26
78 0.21
79 0.15
80 0.13
81 0.13
82 0.13
83 0.13
84 0.13
85 0.11
86 0.12
87 0.1
88 0.15
89 0.14
90 0.16
91 0.16
92 0.16
93 0.17
94 0.19
95 0.18
96 0.14