Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3BUM1

Protein Details
Accession A0A0C3BUM1    Localization Confidence Medium Confidence Score 13.5
NoLS Segment(s)
PositionSequenceProtein Nature
1-28MYNKREPKEEIRRPKSRKGSNTRRSTSEHydrophilic
NLS Segment(s)
PositionSequence
5-20REPKEEIRRPKSRKGS
Subcellular Location(s) nucl 21, cyto_nucl 13.5, cyto 4
Family & Domain DBs
Amino Acid Sequences MYNKREPKEEIRRPKSRKGSNTRRSTSELQASRTIVTIVRASSRDRVITSRILNAAPQGKKYSTEMNKNAPRCTWRDQKVTRLGSAVL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.86
2 0.86
3 0.84
4 0.84
5 0.84
6 0.85
7 0.85
8 0.89
9 0.83
10 0.77
11 0.73
12 0.67
13 0.62
14 0.59
15 0.52
16 0.45
17 0.44
18 0.41
19 0.35
20 0.3
21 0.25
22 0.16
23 0.15
24 0.12
25 0.1
26 0.11
27 0.12
28 0.13
29 0.15
30 0.16
31 0.16
32 0.15
33 0.17
34 0.17
35 0.21
36 0.2
37 0.19
38 0.19
39 0.19
40 0.18
41 0.19
42 0.24
43 0.21
44 0.22
45 0.22
46 0.22
47 0.24
48 0.26
49 0.33
50 0.32
51 0.41
52 0.43
53 0.5
54 0.57
55 0.59
56 0.59
57 0.53
58 0.51
59 0.47
60 0.5
61 0.5
62 0.5
63 0.57
64 0.6
65 0.66
66 0.71
67 0.7
68 0.63