Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2Y7I9

Protein Details
Accession A0A0C2Y7I9   
Localization Confidence Medium
Confidence Score 14
NoLS Segment(s)
PositionSequenceProtein Nature
1-24MAKSLRSKTKRAFRSKKRESGVYAHydrophilic
NLS Segment(s)
PositionSequence
6-18RSKTKRAFRSKKR
77-119PRGSRREEWRKSKGLPARASSHGMNRQGMVAGKRKAGRSQRRR
Subcellular Location(s) mito 15, nucl 10
Family & Domain DBs
InterPro View protein in InterPro  
IPR019434  DUF2423  
Pfam View protein in Pfam  
PF10338  DUF2423  
Amino Acid Sequences MAKSLRSKTKRAFRSKKRESGVYAAAAAGRLQRLNSKLIQTIQKDSEGDVLLEEGDNVPDSMAIDAEPSTKVSTHGPRGSRREEWRKSKGLPARASSHGMNRQGMVAGKRKAGRSQRRR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.88
2 0.9
3 0.9
4 0.86
5 0.82
6 0.75
7 0.71
8 0.64
9 0.54
10 0.44
11 0.35
12 0.29
13 0.23
14 0.18
15 0.13
16 0.1
17 0.09
18 0.09
19 0.13
20 0.15
21 0.17
22 0.2
23 0.21
24 0.22
25 0.26
26 0.31
27 0.3
28 0.32
29 0.31
30 0.3
31 0.28
32 0.26
33 0.25
34 0.18
35 0.16
36 0.11
37 0.1
38 0.08
39 0.07
40 0.07
41 0.04
42 0.04
43 0.04
44 0.04
45 0.03
46 0.03
47 0.04
48 0.04
49 0.04
50 0.03
51 0.04
52 0.04
53 0.05
54 0.05
55 0.06
56 0.06
57 0.06
58 0.08
59 0.12
60 0.17
61 0.23
62 0.28
63 0.32
64 0.39
65 0.44
66 0.48
67 0.51
68 0.56
69 0.6
70 0.64
71 0.68
72 0.69
73 0.69
74 0.66
75 0.68
76 0.65
77 0.64
78 0.6
79 0.56
80 0.54
81 0.51
82 0.53
83 0.46
84 0.47
85 0.45
86 0.43
87 0.39
88 0.34
89 0.32
90 0.3
91 0.32
92 0.28
93 0.3
94 0.29
95 0.34
96 0.37
97 0.4
98 0.47
99 0.54