Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2XEH4

Protein Details
Accession A0A0C2XEH4    Localization Confidence Medium Confidence Score 11.4
NoLS Segment(s)
PositionSequenceProtein Nature
179-198KTYAPPKKLAAKRKNKQYDSHydrophilic
NLS Segment(s)
PositionSequence
60-71GGGRPGPRPKKP
169-193KHRRVQELKDKTYAPPKKLAAKRKN
Subcellular Location(s) mito 19.5, cyto_mito 11.5, nucl 5
Family & Domain DBs
Amino Acid Sequences MNCSCGKTFCARCITNRYPPGRFDYEQKQDNNCPYCQGCCNCTACCSKRGDKYVSSARSGGGRPGPRPKKPVAVPPLAVRERVSLGGKTNLPPPSQLPSEPIKYWGAVYALSGKKITSTFAPQTQEGHPAMVFGLINSEETVDKPKEKKALQPKRVFVGVLQRRWGYSKHRRVQELKDKTYAPPKKLAAKRKNKQYDSEPRWYVGHRARLFWPREEPTEIPLPDDLDDLSPLSSLEDDDPDERGSLQPEERSRAASLGEDVVGQVIALALEACGTGSKVFPALV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.6
2 0.61
3 0.66
4 0.66
5 0.61
6 0.61
7 0.63
8 0.61
9 0.55
10 0.52
11 0.53
12 0.56
13 0.59
14 0.6
15 0.59
16 0.58
17 0.65
18 0.62
19 0.53
20 0.49
21 0.44
22 0.43
23 0.44
24 0.41
25 0.35
26 0.37
27 0.39
28 0.35
29 0.38
30 0.43
31 0.39
32 0.41
33 0.45
34 0.46
35 0.51
36 0.57
37 0.58
38 0.52
39 0.56
40 0.6
41 0.57
42 0.52
43 0.45
44 0.39
45 0.38
46 0.35
47 0.32
48 0.3
49 0.3
50 0.32
51 0.42
52 0.5
53 0.51
54 0.56
55 0.55
56 0.57
57 0.57
58 0.62
59 0.59
60 0.56
61 0.53
62 0.52
63 0.57
64 0.48
65 0.45
66 0.36
67 0.31
68 0.26
69 0.27
70 0.24
71 0.17
72 0.18
73 0.22
74 0.22
75 0.22
76 0.26
77 0.26
78 0.25
79 0.25
80 0.24
81 0.25
82 0.25
83 0.24
84 0.23
85 0.24
86 0.27
87 0.26
88 0.27
89 0.23
90 0.21
91 0.21
92 0.18
93 0.14
94 0.11
95 0.11
96 0.16
97 0.16
98 0.16
99 0.16
100 0.14
101 0.15
102 0.16
103 0.16
104 0.1
105 0.15
106 0.17
107 0.21
108 0.23
109 0.22
110 0.25
111 0.25
112 0.27
113 0.22
114 0.2
115 0.16
116 0.13
117 0.13
118 0.11
119 0.1
120 0.05
121 0.05
122 0.05
123 0.05
124 0.05
125 0.06
126 0.05
127 0.06
128 0.1
129 0.1
130 0.13
131 0.14
132 0.17
133 0.23
134 0.24
135 0.32
136 0.39
137 0.49
138 0.56
139 0.61
140 0.6
141 0.57
142 0.57
143 0.49
144 0.39
145 0.39
146 0.35
147 0.3
148 0.31
149 0.28
150 0.28
151 0.29
152 0.31
153 0.3
154 0.34
155 0.43
156 0.48
157 0.53
158 0.59
159 0.62
160 0.7
161 0.71
162 0.69
163 0.63
164 0.59
165 0.55
166 0.51
167 0.57
168 0.52
169 0.44
170 0.42
171 0.41
172 0.47
173 0.53
174 0.62
175 0.62
176 0.67
177 0.73
178 0.77
179 0.84
180 0.77
181 0.76
182 0.75
183 0.76
184 0.72
185 0.73
186 0.63
187 0.55
188 0.53
189 0.49
190 0.47
191 0.42
192 0.44
193 0.36
194 0.38
195 0.41
196 0.48
197 0.5
198 0.46
199 0.47
200 0.4
201 0.43
202 0.45
203 0.4
204 0.36
205 0.41
206 0.37
207 0.31
208 0.28
209 0.26
210 0.21
211 0.21
212 0.17
213 0.1
214 0.11
215 0.1
216 0.09
217 0.08
218 0.07
219 0.07
220 0.07
221 0.07
222 0.08
223 0.09
224 0.1
225 0.11
226 0.13
227 0.13
228 0.13
229 0.13
230 0.13
231 0.15
232 0.16
233 0.18
234 0.23
235 0.26
236 0.32
237 0.32
238 0.34
239 0.32
240 0.3
241 0.28
242 0.23
243 0.21
244 0.17
245 0.16
246 0.13
247 0.12
248 0.11
249 0.1
250 0.08
251 0.06
252 0.04
253 0.04
254 0.04
255 0.04
256 0.03
257 0.03
258 0.04
259 0.04
260 0.04
261 0.05
262 0.06
263 0.07
264 0.08