Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3CDN1

Protein Details
Accession A0A0C3CDN1    Localization Confidence Medium Confidence Score 10.5
NoLS Segment(s)
PositionSequenceProtein Nature
13-32YKKGKDSKFAQGKRRYDRKQBasic
NLS Segment(s)
PositionSequence
15-31KGKDSKFAQGKRRYDRK
Subcellular Location(s) mito 11, nucl 9, cyto_nucl 9, cyto 7
Family & Domain DBs
InterPro View protein in InterPro  
IPR000552  Ribosomal_L44e  
IPR011332  Ribosomal_zn-bd  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF00935  Ribosomal_L44  
PROSITE View protein in PROSITE  
PS01172  RIBOSOMAL_L44E  
Amino Acid Sequences MVNIPKLHKVTQYKKGKDSKFAQGKRRYDRKQSGYGGQTKPVFHKKAKTTKKVVLRLECTVFELGGEKKTKGAALTF
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.7
2 0.77
3 0.72
4 0.71
5 0.68
6 0.69
7 0.69
8 0.7
9 0.71
10 0.71
11 0.76
12 0.77
13 0.82
14 0.77
15 0.76
16 0.79
17 0.75
18 0.74
19 0.68
20 0.64
21 0.59
22 0.61
23 0.52
24 0.46
25 0.42
26 0.35
27 0.36
28 0.38
29 0.36
30 0.31
31 0.38
32 0.42
33 0.51
34 0.59
35 0.63
36 0.62
37 0.66
38 0.73
39 0.74
40 0.73
41 0.7
42 0.65
43 0.61
44 0.57
45 0.5
46 0.43
47 0.35
48 0.28
49 0.2
50 0.18
51 0.15
52 0.18
53 0.2
54 0.18
55 0.19
56 0.2
57 0.22