Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C2Y1P3

Protein Details
Accession A0A0C2Y1P3    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
76-95HRAGKTVGKHCRKAKNPWGWBasic
NLS Segment(s)
Subcellular Location(s) extr 22, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR008427  Extracellular_membr_CFEM_dom  
Pfam View protein in Pfam  
PF05730  CFEM  
Amino Acid Sequences MRFTSIAFALLGVVATASAATTLEARGDGFPHCVQKCHGNRFGCNPKDWDCFCKNNNWKGWFEGCCKDNCHGDDFHRAGKTVGKHCRKAKNPWGW
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.03
2 0.03
3 0.03
4 0.03
5 0.03
6 0.03
7 0.03
8 0.04
9 0.04
10 0.05
11 0.05
12 0.06
13 0.06
14 0.08
15 0.08
16 0.11
17 0.13
18 0.19
19 0.2
20 0.2
21 0.21
22 0.3
23 0.36
24 0.4
25 0.45
26 0.41
27 0.42
28 0.49
29 0.57
30 0.5
31 0.45
32 0.41
33 0.39
34 0.41
35 0.41
36 0.38
37 0.33
38 0.36
39 0.35
40 0.42
41 0.44
42 0.46
43 0.52
44 0.49
45 0.47
46 0.45
47 0.49
48 0.42
49 0.4
50 0.38
51 0.33
52 0.32
53 0.33
54 0.32
55 0.33
56 0.31
57 0.3
58 0.27
59 0.28
60 0.35
61 0.35
62 0.37
63 0.33
64 0.32
65 0.29
66 0.32
67 0.36
68 0.36
69 0.44
70 0.48
71 0.56
72 0.64
73 0.74
74 0.75
75 0.79