Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3BMS2

Protein Details
Accession A0A0C3BMS2    Localization Confidence Medium Confidence Score 12.1
NoLS Segment(s)
PositionSequenceProtein Nature
155-179GVGKATGKRKAGKSKRKQGAGFGKRBasic
NLS Segment(s)
PositionSequence
149-180AKKKKVGVGKATGKRKAGKSKRKQGAGFGKRM
Subcellular Location(s) nucl 14.5, cyto_nucl 10, cyto 4.5, mito 2, golg 2, vacu 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MTDDEKPLSPTAQDDIDESDWDEVDGDGDGDDEKTPLLSSPDSEPSGSSRSTSPEPNADSRFSPPPPSPLKRISLLTFIVLLLFVGFHMRGDLLEAKRKPKIIHASRYSKDYKFRPAASPIITETLKDGRLRLRGALPTPTATTTPAVAKKKKVGVGKATGKRKAGKSKRKQGAGFGKRM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.2
3 0.2
4 0.2
5 0.19
6 0.17
7 0.15
8 0.14
9 0.13
10 0.08
11 0.07
12 0.07
13 0.06
14 0.05
15 0.05
16 0.05
17 0.06
18 0.06
19 0.06
20 0.05
21 0.06
22 0.06
23 0.07
24 0.09
25 0.09
26 0.1
27 0.14
28 0.19
29 0.2
30 0.2
31 0.2
32 0.2
33 0.22
34 0.2
35 0.18
36 0.14
37 0.17
38 0.2
39 0.23
40 0.22
41 0.25
42 0.28
43 0.32
44 0.33
45 0.31
46 0.3
47 0.3
48 0.32
49 0.28
50 0.29
51 0.25
52 0.29
53 0.35
54 0.38
55 0.39
56 0.38
57 0.41
58 0.39
59 0.41
60 0.35
61 0.31
62 0.28
63 0.23
64 0.19
65 0.15
66 0.12
67 0.1
68 0.08
69 0.04
70 0.03
71 0.03
72 0.03
73 0.03
74 0.03
75 0.03
76 0.03
77 0.03
78 0.05
79 0.1
80 0.1
81 0.18
82 0.19
83 0.22
84 0.24
85 0.27
86 0.26
87 0.29
88 0.38
89 0.39
90 0.47
91 0.52
92 0.59
93 0.57
94 0.62
95 0.59
96 0.51
97 0.51
98 0.45
99 0.45
100 0.42
101 0.44
102 0.43
103 0.42
104 0.44
105 0.39
106 0.37
107 0.29
108 0.28
109 0.25
110 0.21
111 0.19
112 0.18
113 0.18
114 0.17
115 0.18
116 0.18
117 0.23
118 0.24
119 0.24
120 0.26
121 0.27
122 0.29
123 0.32
124 0.28
125 0.26
126 0.27
127 0.26
128 0.22
129 0.2
130 0.18
131 0.16
132 0.2
133 0.26
134 0.32
135 0.35
136 0.39
137 0.44
138 0.5
139 0.54
140 0.55
141 0.55
142 0.55
143 0.61
144 0.66
145 0.68
146 0.71
147 0.7
148 0.69
149 0.69
150 0.69
151 0.71
152 0.71
153 0.74
154 0.76
155 0.82
156 0.86
157 0.88
158 0.82
159 0.82
160 0.82