Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3C8X7

Protein Details
Accession A0A0C3C8X7    Localization Confidence Medium Confidence Score 13.1
NoLS Segment(s)
PositionSequenceProtein Nature
162-186SFVPARPIKPLPKRANKPRPEIIVLHydrophilic
NLS Segment(s)
PositionSequence
171-178PLPKRANK
Subcellular Location(s) nucl 21.5, cyto_nucl 15, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR027921  NOPCHAP1  
Gene Ontology GO:0000492  P:box C/D snoRNP assembly  
Pfam View protein in Pfam  
PF15370  NOPCHAP1  
Amino Acid Sequences MDERGPTPRVVLDVEDDEQRQARIQSYLEKINSSAQPTRAFDNPIPQFDFGDRTTFPVKPNSELLSRVQAFLPQMEASNTMLSQRMQDDPASVDIEHIPEGMDQYIEMNLGLGVFEDRSHTTEDSEMSTSSSSDDSSDSSDKAQEEDDSDLDSDASSLIITSFVPARPIKPLPKRANKPRPEIIVLDENKH
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.22
2 0.23
3 0.23
4 0.22
5 0.22
6 0.21
7 0.2
8 0.17
9 0.18
10 0.17
11 0.19
12 0.24
13 0.28
14 0.34
15 0.33
16 0.32
17 0.31
18 0.34
19 0.35
20 0.33
21 0.33
22 0.3
23 0.34
24 0.35
25 0.37
26 0.33
27 0.35
28 0.31
29 0.37
30 0.37
31 0.35
32 0.36
33 0.33
34 0.31
35 0.28
36 0.31
37 0.21
38 0.21
39 0.18
40 0.19
41 0.22
42 0.22
43 0.23
44 0.27
45 0.27
46 0.27
47 0.3
48 0.29
49 0.27
50 0.27
51 0.28
52 0.28
53 0.27
54 0.25
55 0.22
56 0.21
57 0.19
58 0.18
59 0.17
60 0.1
61 0.09
62 0.09
63 0.1
64 0.1
65 0.1
66 0.09
67 0.08
68 0.09
69 0.09
70 0.09
71 0.09
72 0.1
73 0.1
74 0.1
75 0.1
76 0.1
77 0.12
78 0.12
79 0.1
80 0.1
81 0.09
82 0.09
83 0.08
84 0.07
85 0.06
86 0.05
87 0.05
88 0.05
89 0.04
90 0.04
91 0.04
92 0.04
93 0.04
94 0.04
95 0.03
96 0.03
97 0.03
98 0.03
99 0.03
100 0.03
101 0.03
102 0.03
103 0.05
104 0.06
105 0.08
106 0.1
107 0.11
108 0.11
109 0.12
110 0.13
111 0.13
112 0.13
113 0.12
114 0.11
115 0.11
116 0.1
117 0.1
118 0.1
119 0.08
120 0.07
121 0.08
122 0.08
123 0.11
124 0.13
125 0.12
126 0.13
127 0.15
128 0.15
129 0.15
130 0.15
131 0.12
132 0.13
133 0.15
134 0.14
135 0.13
136 0.13
137 0.12
138 0.11
139 0.1
140 0.08
141 0.06
142 0.06
143 0.04
144 0.04
145 0.04
146 0.04
147 0.04
148 0.06
149 0.08
150 0.08
151 0.13
152 0.14
153 0.15
154 0.21
155 0.28
156 0.36
157 0.44
158 0.54
159 0.6
160 0.71
161 0.8
162 0.85
163 0.9
164 0.88
165 0.87
166 0.85
167 0.82
168 0.75
169 0.67
170 0.61
171 0.6