Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2XRP4

Protein Details
Accession A0A0C2XRP4   
Localization Confidence Low
Confidence Score 9.9
NoLS Segment(s)
PositionSequenceProtein Nature
170-189YENYAKKKERSIRDNKNSESHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 18.5, cyto_nucl 13.5, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR000996  Clathrin_L-chain  
Gene Ontology GO:0030132  C:clathrin coat of coated pit  
GO:0030130  C:clathrin coat of trans-Golgi network vesicle  
GO:0005198  F:structural molecule activity  
GO:0006886  P:intracellular protein transport  
GO:0016192  P:vesicle-mediated transport  
Pfam View protein in Pfam  
PF01086  Clathrin_lg_ch  
Amino Acid Sequences MSDIFGGEFSSSFQSTVTDEIDFDRAASAFPDISLDGSTEFPSAPPPAAGRTNSGFSFEDFDAPVPQNNTAVKVTGDDEIDKFESEFPDIDVPSYSAPQQPAFTATFAPQPQPSAFSSTPILNQTIEDEPQVIKDWREKQQEEIKARDAESKVRREETIDKAERAIEEFYENYAKKKERSIRDNKNSESEYLAELQASLSTGTTWERICSLVELQNSQSKSIARTGPGATDLSRFKEVLLRLKREGDAAPGAAGY
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.12
2 0.13
3 0.16
4 0.15
5 0.12
6 0.12
7 0.14
8 0.16
9 0.15
10 0.14
11 0.13
12 0.11
13 0.11
14 0.11
15 0.1
16 0.08
17 0.08
18 0.1
19 0.08
20 0.09
21 0.09
22 0.09
23 0.09
24 0.1
25 0.11
26 0.1
27 0.1
28 0.09
29 0.11
30 0.12
31 0.12
32 0.12
33 0.12
34 0.16
35 0.2
36 0.21
37 0.22
38 0.24
39 0.27
40 0.26
41 0.28
42 0.25
43 0.21
44 0.25
45 0.21
46 0.2
47 0.17
48 0.17
49 0.17
50 0.17
51 0.18
52 0.15
53 0.15
54 0.17
55 0.17
56 0.19
57 0.16
58 0.16
59 0.14
60 0.14
61 0.15
62 0.14
63 0.14
64 0.12
65 0.12
66 0.13
67 0.14
68 0.13
69 0.12
70 0.12
71 0.11
72 0.11
73 0.11
74 0.1
75 0.11
76 0.11
77 0.11
78 0.1
79 0.1
80 0.1
81 0.1
82 0.1
83 0.1
84 0.12
85 0.12
86 0.12
87 0.12
88 0.14
89 0.14
90 0.14
91 0.12
92 0.12
93 0.15
94 0.15
95 0.16
96 0.14
97 0.15
98 0.14
99 0.16
100 0.16
101 0.19
102 0.18
103 0.18
104 0.19
105 0.18
106 0.19
107 0.18
108 0.18
109 0.11
110 0.11
111 0.12
112 0.11
113 0.11
114 0.1
115 0.09
116 0.08
117 0.09
118 0.11
119 0.09
120 0.09
121 0.15
122 0.2
123 0.27
124 0.34
125 0.34
126 0.37
127 0.45
128 0.52
129 0.49
130 0.47
131 0.44
132 0.39
133 0.39
134 0.38
135 0.31
136 0.32
137 0.35
138 0.37
139 0.35
140 0.36
141 0.35
142 0.34
143 0.39
144 0.37
145 0.41
146 0.38
147 0.36
148 0.35
149 0.35
150 0.31
151 0.27
152 0.21
153 0.12
154 0.11
155 0.1
156 0.12
157 0.17
158 0.17
159 0.17
160 0.22
161 0.24
162 0.24
163 0.33
164 0.4
165 0.43
166 0.53
167 0.62
168 0.68
169 0.75
170 0.81
171 0.75
172 0.73
173 0.66
174 0.57
175 0.48
176 0.38
177 0.29
178 0.23
179 0.21
180 0.14
181 0.12
182 0.11
183 0.09
184 0.08
185 0.07
186 0.05
187 0.05
188 0.06
189 0.07
190 0.09
191 0.09
192 0.1
193 0.1
194 0.11
195 0.12
196 0.13
197 0.15
198 0.18
199 0.19
200 0.21
201 0.23
202 0.27
203 0.27
204 0.26
205 0.25
206 0.22
207 0.23
208 0.27
209 0.27
210 0.24
211 0.27
212 0.27
213 0.27
214 0.27
215 0.27
216 0.22
217 0.23
218 0.24
219 0.25
220 0.27
221 0.25
222 0.23
223 0.27
224 0.3
225 0.35
226 0.42
227 0.43
228 0.44
229 0.48
230 0.48
231 0.45
232 0.43
233 0.38
234 0.32
235 0.27