Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3C062

Protein Details
Accession A0A0C3C062    Localization Confidence Low Confidence Score 9.1
NoLS Segment(s)
PositionSequenceProtein Nature
6-33YLNFTARWRKIWRSRKKRCFSRVSTTFDHydrophilic
NLS Segment(s)
PositionSequence
18-21RSRK
Subcellular Location(s) mito 21, nucl 3, cyto 1, plas 1, golg 1
Family & Domain DBs
Amino Acid Sequences MLLFIYLNFTARWRKIWRSRKKRCFSRVSTTFDVRMQWLFFLGWGHKSNPLYFIRHFNQDRTFTLFLIPAEV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.5
3 0.6
4 0.68
5 0.73
6 0.82
7 0.87
8 0.92
9 0.92
10 0.91
11 0.9
12 0.86
13 0.85
14 0.81
15 0.77
16 0.72
17 0.64
18 0.56
19 0.47
20 0.41
21 0.31
22 0.24
23 0.17
24 0.12
25 0.1
26 0.08
27 0.07
28 0.08
29 0.08
30 0.11
31 0.12
32 0.14
33 0.18
34 0.19
35 0.19
36 0.24
37 0.25
38 0.26
39 0.26
40 0.33
41 0.32
42 0.4
43 0.41
44 0.41
45 0.45
46 0.45
47 0.46
48 0.45
49 0.43
50 0.34
51 0.34
52 0.31