Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2XSF4

Protein Details
Accession A0A0C2XSF4    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
39-68SISRSDTSKKKRTVKARTFHRQQHPVPRGTHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 14, nucl 12
Family & Domain DBs
Amino Acid Sequences MIVKGFLIFCKNDRYITYANVEATTLWDALSRKFPQILSISRSDTSKKKRTVKARTFHRQQHPVPRGT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.29
3 0.3
4 0.31
5 0.26
6 0.25
7 0.23
8 0.22
9 0.16
10 0.16
11 0.14
12 0.1
13 0.08
14 0.1
15 0.1
16 0.11
17 0.17
18 0.16
19 0.16
20 0.17
21 0.17
22 0.18
23 0.22
24 0.24
25 0.21
26 0.23
27 0.25
28 0.24
29 0.26
30 0.26
31 0.3
32 0.36
33 0.42
34 0.48
35 0.55
36 0.63
37 0.72
38 0.8
39 0.81
40 0.82
41 0.84
42 0.86
43 0.86
44 0.87
45 0.87
46 0.85
47 0.82
48 0.84