Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C2YZN6

Protein Details
Accession A0A0C2YZN6    Localization Confidence Low Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
65-86IEKRNTCDKHAKRKDLSCPLLKHydrophilic
NLS Segment(s)
Subcellular Location(s) extr 16, mito 9
Family & Domain DBs
Amino Acid Sequences MAKQLKVVSISLILAIASILRLQLVSGVPLRGAVKGRGEAASGDLRTPHPSQLSGFTEFLQEKHIEKRNTCDKHAKRKDLSCPLLK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.07
2 0.07
3 0.05
4 0.04
5 0.04
6 0.04
7 0.03
8 0.04
9 0.03
10 0.06
11 0.06
12 0.07
13 0.08
14 0.09
15 0.09
16 0.1
17 0.11
18 0.11
19 0.12
20 0.12
21 0.12
22 0.13
23 0.15
24 0.13
25 0.13
26 0.11
27 0.12
28 0.13
29 0.12
30 0.11
31 0.11
32 0.11
33 0.15
34 0.15
35 0.15
36 0.13
37 0.14
38 0.15
39 0.19
40 0.22
41 0.22
42 0.21
43 0.2
44 0.22
45 0.22
46 0.21
47 0.19
48 0.17
49 0.16
50 0.23
51 0.31
52 0.32
53 0.33
54 0.42
55 0.49
56 0.52
57 0.56
58 0.59
59 0.61
60 0.68
61 0.77
62 0.78
63 0.76
64 0.79
65 0.84
66 0.83