Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3CBT7

Protein Details
Accession A0A0C3CBT7    Localization Confidence Low Confidence Score 8.9
NoLS Segment(s)
PositionSequenceProtein Nature
45-65VPSHGSRRSGRHRRHYHNDSYBasic
NLS Segment(s)
Subcellular Location(s) nucl 12.5, mito 11, cyto_nucl 8.5
Family & Domain DBs
Amino Acid Sequences MTAYYPSQAGYATTQPVVYNPSMGYSQPYGVAASYAQPAGGVMYVPSHGSRRSGRHRRHYHNDSYSVPQVATVGAPVVMQPSYAGHHHHYSFGARLRRFFGLAPRSGVRYKSDHGTWGFMGYSRRQRYIDPRTGGEVDRQGRPVYRV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.17
2 0.17
3 0.18
4 0.2
5 0.17
6 0.16
7 0.13
8 0.15
9 0.15
10 0.15
11 0.18
12 0.15
13 0.15
14 0.14
15 0.15
16 0.13
17 0.12
18 0.12
19 0.09
20 0.09
21 0.09
22 0.08
23 0.07
24 0.07
25 0.07
26 0.07
27 0.06
28 0.05
29 0.04
30 0.04
31 0.05
32 0.06
33 0.07
34 0.08
35 0.09
36 0.13
37 0.17
38 0.24
39 0.35
40 0.44
41 0.52
42 0.61
43 0.7
44 0.76
45 0.82
46 0.81
47 0.79
48 0.74
49 0.7
50 0.62
51 0.56
52 0.49
53 0.39
54 0.32
55 0.22
56 0.17
57 0.13
58 0.1
59 0.06
60 0.04
61 0.03
62 0.03
63 0.03
64 0.04
65 0.04
66 0.04
67 0.04
68 0.04
69 0.06
70 0.07
71 0.1
72 0.11
73 0.15
74 0.15
75 0.16
76 0.17
77 0.16
78 0.19
79 0.23
80 0.27
81 0.25
82 0.26
83 0.28
84 0.29
85 0.28
86 0.26
87 0.29
88 0.27
89 0.28
90 0.3
91 0.29
92 0.31
93 0.32
94 0.33
95 0.28
96 0.26
97 0.27
98 0.28
99 0.28
100 0.3
101 0.3
102 0.31
103 0.28
104 0.25
105 0.23
106 0.2
107 0.22
108 0.23
109 0.32
110 0.33
111 0.36
112 0.36
113 0.41
114 0.49
115 0.56
116 0.59
117 0.54
118 0.52
119 0.54
120 0.55
121 0.51
122 0.46
123 0.44
124 0.39
125 0.38
126 0.38
127 0.34