Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C2Z7L6

Protein Details
Accession A0A0C2Z7L6    Localization Confidence Medium Confidence Score 12
NoLS Segment(s)
PositionSequenceProtein Nature
1-22MGKRKKSSRKPGPSRQKVPLETBasic
NLS Segment(s)
PositionSequence
3-15KRKKSSRKPGPSR
Subcellular Location(s) nucl 13.5, mito 13, cyto_nucl 7.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR007808  Elf1  
IPR038567  T_Elf1_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0046872  F:metal ion binding  
Pfam View protein in Pfam  
PF05129  Elf1  
Amino Acid Sequences MGKRKKSSRKPGPSRQKVPLETTFTCLFCHHDKSVTVRLDRKEGMAQLVCRVCDQRYQSKVNHLTEPIDIYSEWIDAADAAQREEVPRRAVASSSRPIPAPPSVDSDED
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.91
2 0.88
3 0.86
4 0.79
5 0.75
6 0.71
7 0.67
8 0.57
9 0.54
10 0.48
11 0.39
12 0.36
13 0.3
14 0.27
15 0.23
16 0.27
17 0.24
18 0.24
19 0.25
20 0.29
21 0.36
22 0.36
23 0.37
24 0.37
25 0.37
26 0.39
27 0.38
28 0.34
29 0.28
30 0.25
31 0.24
32 0.21
33 0.2
34 0.2
35 0.21
36 0.19
37 0.17
38 0.18
39 0.15
40 0.17
41 0.2
42 0.24
43 0.28
44 0.31
45 0.32
46 0.4
47 0.46
48 0.44
49 0.43
50 0.36
51 0.32
52 0.29
53 0.29
54 0.2
55 0.15
56 0.12
57 0.11
58 0.1
59 0.09
60 0.08
61 0.06
62 0.06
63 0.05
64 0.05
65 0.07
66 0.07
67 0.07
68 0.08
69 0.08
70 0.1
71 0.15
72 0.18
73 0.17
74 0.18
75 0.2
76 0.2
77 0.22
78 0.25
79 0.28
80 0.31
81 0.32
82 0.32
83 0.31
84 0.31
85 0.33
86 0.33
87 0.3
88 0.26
89 0.3