Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3C769

Protein Details
Accession A0A0C3C769    Localization Confidence Medium Confidence Score 11.7
NoLS Segment(s)
PositionSequenceProtein Nature
16-41EPMVLRREVHKRKWEGRREPPRYITYBasic
NLS Segment(s)
PositionSequence
27-28RK
Subcellular Location(s) nucl 18, mito_nucl 12.499, cyto_nucl 12.333, mito 5.5
Family & Domain DBs
Amino Acid Sequences MKLVRPTVIPHGHDAEPMVLRREVHKRKWEGRREPPRYITYPTNARARAPPSDTNVQNLDSPNMGKPTWNRLASPPIYEGHGEINACQTQIHRRKVDTAAKMESSGDATQKLGFPSRLQMPNRKPKTSISSNPNPAELSLPHSCEHHGTMIRLAIQDISMIKTHNTTWIATGSPKRNSPSHSPNWYKTTTPYVSSGANRVLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.35
2 0.3
3 0.26
4 0.26
5 0.25
6 0.22
7 0.22
8 0.27
9 0.36
10 0.41
11 0.47
12 0.55
13 0.6
14 0.69
15 0.78
16 0.83
17 0.83
18 0.85
19 0.88
20 0.85
21 0.84
22 0.81
23 0.77
24 0.7
25 0.66
26 0.6
27 0.55
28 0.55
29 0.52
30 0.52
31 0.47
32 0.45
33 0.44
34 0.43
35 0.42
36 0.4
37 0.39
38 0.37
39 0.44
40 0.43
41 0.41
42 0.39
43 0.35
44 0.32
45 0.29
46 0.24
47 0.17
48 0.18
49 0.16
50 0.17
51 0.15
52 0.15
53 0.17
54 0.24
55 0.3
56 0.3
57 0.29
58 0.3
59 0.37
60 0.36
61 0.36
62 0.29
63 0.22
64 0.22
65 0.21
66 0.19
67 0.13
68 0.14
69 0.11
70 0.1
71 0.12
72 0.11
73 0.1
74 0.1
75 0.09
76 0.18
77 0.26
78 0.32
79 0.31
80 0.32
81 0.36
82 0.43
83 0.49
84 0.43
85 0.39
86 0.35
87 0.33
88 0.33
89 0.29
90 0.22
91 0.17
92 0.14
93 0.11
94 0.09
95 0.09
96 0.09
97 0.1
98 0.11
99 0.1
100 0.1
101 0.1
102 0.13
103 0.19
104 0.25
105 0.27
106 0.35
107 0.42
108 0.52
109 0.58
110 0.56
111 0.52
112 0.5
113 0.55
114 0.55
115 0.54
116 0.52
117 0.55
118 0.6
119 0.59
120 0.56
121 0.48
122 0.4
123 0.34
124 0.26
125 0.23
126 0.18
127 0.19
128 0.18
129 0.19
130 0.19
131 0.19
132 0.19
133 0.18
134 0.18
135 0.17
136 0.18
137 0.19
138 0.2
139 0.18
140 0.17
141 0.12
142 0.1
143 0.11
144 0.1
145 0.1
146 0.1
147 0.1
148 0.1
149 0.12
150 0.12
151 0.17
152 0.18
153 0.16
154 0.17
155 0.18
156 0.19
157 0.23
158 0.3
159 0.31
160 0.35
161 0.39
162 0.41
163 0.44
164 0.48
165 0.52
166 0.54
167 0.57
168 0.62
169 0.65
170 0.68
171 0.69
172 0.67
173 0.6
174 0.54
175 0.54
176 0.46
177 0.42
178 0.38
179 0.35
180 0.37
181 0.37
182 0.37