Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2XSY3

Protein Details
Accession A0A0C2XSY3    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
82-121GQGTKARKPKEPKAPKEPKAKAAPKKKAAPKKKAETEEEDBasic
NLS Segment(s)
PositionSequence
23-26RPKK
83-114QGTKARKPKEPKAPKEPKAKAAPKKKAAPKKK
Subcellular Location(s) nucl 17, cyto_nucl 12.5, cyto 6, mito 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009071  HMG_box_dom  
IPR036910  HMG_box_dom_sf  
Gene Ontology GO:0005634  C:nucleus  
GO:0003677  F:DNA binding  
PROSITE View protein in PROSITE  
PS50118  HMG_BOX_2  
CDD cd00084  HMG-box_SF  
Amino Acid Sequences MAKTATETKTKAATKAAVTKTARPKKDKVDAADKPKREPTAYQVFCKEHMKKWNEENPGRAKEAMTQIALMWKDAPENPNRGQGTKARKPKEPKAPKEPKAKAAPKKKAAPKKKAETEEEDPSEAGDDADDGSE
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.37
2 0.45
3 0.44
4 0.44
5 0.45
6 0.51
7 0.57
8 0.63
9 0.64
10 0.61
11 0.64
12 0.65
13 0.72
14 0.7
15 0.66
16 0.67
17 0.68
18 0.72
19 0.74
20 0.67
21 0.62
22 0.6
23 0.57
24 0.48
25 0.42
26 0.39
27 0.42
28 0.43
29 0.42
30 0.42
31 0.4
32 0.41
33 0.46
34 0.42
35 0.37
36 0.43
37 0.43
38 0.42
39 0.49
40 0.54
41 0.55
42 0.53
43 0.54
44 0.52
45 0.51
46 0.48
47 0.4
48 0.33
49 0.28
50 0.29
51 0.25
52 0.17
53 0.15
54 0.13
55 0.16
56 0.16
57 0.12
58 0.09
59 0.08
60 0.08
61 0.1
62 0.12
63 0.12
64 0.17
65 0.19
66 0.26
67 0.26
68 0.26
69 0.27
70 0.31
71 0.38
72 0.42
73 0.49
74 0.46
75 0.53
76 0.6
77 0.67
78 0.72
79 0.73
80 0.73
81 0.75
82 0.82
83 0.82
84 0.86
85 0.81
86 0.78
87 0.78
88 0.79
89 0.77
90 0.77
91 0.79
92 0.77
93 0.82
94 0.83
95 0.84
96 0.85
97 0.86
98 0.85
99 0.86
100 0.87
101 0.84
102 0.81
103 0.78
104 0.74
105 0.73
106 0.66
107 0.57
108 0.47
109 0.4
110 0.35
111 0.26
112 0.2
113 0.11
114 0.08