Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3CPP2

Protein Details
Accession A0A0C3CPP2   
Localization Confidence Low
Confidence Score 5
NoLS Segment(s)
PositionSequenceProtein Nature
12-32IISYRRPWPSPKKKGRDTAFWHydrophilic
NLS Segment(s)
Subcellular Location(s) plas 14, mito 9, E.R. 2
Family & Domain DBs
Gene Ontology GO:0016020  C:membrane  
Amino Acid Sequences MCCPDRSVLVAIISYRRPWPSPKKKGRDTAFWPAEGFLGKQDPCVFCSCSIRISTILAFCVSTMTRSIMLAFFICRISRN
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.2
2 0.21
3 0.21
4 0.23
5 0.3
6 0.4
7 0.48
8 0.58
9 0.66
10 0.73
11 0.78
12 0.85
13 0.82
14 0.79
15 0.75
16 0.75
17 0.66
18 0.57
19 0.49
20 0.4
21 0.35
22 0.27
23 0.19
24 0.1
25 0.1
26 0.1
27 0.1
28 0.13
29 0.13
30 0.14
31 0.16
32 0.17
33 0.15
34 0.19
35 0.19
36 0.18
37 0.19
38 0.18
39 0.17
40 0.17
41 0.17
42 0.14
43 0.14
44 0.12
45 0.12
46 0.1
47 0.11
48 0.1
49 0.09
50 0.1
51 0.11
52 0.11
53 0.11
54 0.13
55 0.11
56 0.12
57 0.12
58 0.12
59 0.11
60 0.13