Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3C2Z8

Protein Details
Accession A0A0C3C2Z8    Localization Confidence Medium Confidence Score 13.3
NoLS Segment(s)
PositionSequenceProtein Nature
203-226ETINRLLKKQSKPRNKRIDDRSPLHydrophilic
318-338IDGCGKPRKYRLPKDWTIGACHydrophilic
NLS Segment(s)
PositionSequence
186-219ARKRKNLSEKKLEDEKAETINRLLKKQSKPRNKR
Subcellular Location(s) nucl 11.5, mito 9, cyto_nucl 9, cyto 5.5
Family & Domain DBs
InterPro View protein in InterPro  
IPR029523  INO80B/Ies2  
IPR006880  INO80B_C  
Gene Ontology GO:0031011  C:Ino80 complex  
GO:0006338  P:chromatin remodeling  
Pfam View protein in Pfam  
PF04795  PAPA-1  
Amino Acid Sequences MAPRTRRSAAVAAAALVADMQIDSEEEEEQVDVEAEDDVDEGDEEEEEADVEDSQSEEERPVVATPTQPRLKITLRLPAHNASSAGTPTPDELEYAAFKRTPRRRAKIIQDVDIESEDPQSESEEGRYIPDVPPGVPSAGAKPMTTRQAVLASVVDPTHVSLDEGSRSKKQPLNATELALRREETARKRKNLSEKKLEDEKAETINRLLKKQSKPRNKRIDDRSPLPSASGSRTPKVKSNDADDVEGDEDEDDAMDVVDTPQEVKPHMYRWVSSLRGEEQNVEMAITFSVPENLVSPKPVAETTPAARPGAGPGICAIDGCGKPRKYRLPKDWTIGACDSTHLRLLSA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.25
2 0.19
3 0.14
4 0.1
5 0.05
6 0.04
7 0.03
8 0.03
9 0.04
10 0.05
11 0.06
12 0.07
13 0.07
14 0.07
15 0.07
16 0.07
17 0.07
18 0.07
19 0.06
20 0.06
21 0.06
22 0.05
23 0.05
24 0.05
25 0.05
26 0.05
27 0.05
28 0.05
29 0.05
30 0.05
31 0.05
32 0.05
33 0.05
34 0.05
35 0.06
36 0.06
37 0.05
38 0.06
39 0.06
40 0.06
41 0.07
42 0.08
43 0.08
44 0.08
45 0.08
46 0.09
47 0.1
48 0.1
49 0.12
50 0.12
51 0.17
52 0.21
53 0.3
54 0.33
55 0.33
56 0.34
57 0.37
58 0.4
59 0.42
60 0.41
61 0.41
62 0.4
63 0.43
64 0.46
65 0.43
66 0.41
67 0.36
68 0.33
69 0.24
70 0.23
71 0.2
72 0.17
73 0.14
74 0.12
75 0.1
76 0.12
77 0.11
78 0.1
79 0.09
80 0.11
81 0.12
82 0.13
83 0.14
84 0.14
85 0.15
86 0.25
87 0.32
88 0.41
89 0.49
90 0.55
91 0.62
92 0.69
93 0.77
94 0.78
95 0.75
96 0.7
97 0.63
98 0.56
99 0.49
100 0.41
101 0.32
102 0.21
103 0.17
104 0.12
105 0.09
106 0.08
107 0.08
108 0.08
109 0.08
110 0.09
111 0.09
112 0.09
113 0.1
114 0.11
115 0.11
116 0.11
117 0.13
118 0.13
119 0.12
120 0.13
121 0.13
122 0.12
123 0.11
124 0.11
125 0.1
126 0.13
127 0.14
128 0.12
129 0.13
130 0.16
131 0.19
132 0.19
133 0.18
134 0.15
135 0.16
136 0.16
137 0.15
138 0.12
139 0.09
140 0.09
141 0.09
142 0.07
143 0.06
144 0.06
145 0.06
146 0.05
147 0.05
148 0.05
149 0.06
150 0.09
151 0.11
152 0.13
153 0.16
154 0.17
155 0.22
156 0.24
157 0.27
158 0.32
159 0.33
160 0.39
161 0.37
162 0.37
163 0.36
164 0.35
165 0.33
166 0.26
167 0.23
168 0.16
169 0.17
170 0.22
171 0.26
172 0.35
173 0.4
174 0.44
175 0.48
176 0.52
177 0.61
178 0.66
179 0.65
180 0.65
181 0.61
182 0.63
183 0.66
184 0.62
185 0.53
186 0.45
187 0.39
188 0.33
189 0.31
190 0.25
191 0.19
192 0.24
193 0.24
194 0.23
195 0.26
196 0.28
197 0.36
198 0.46
199 0.54
200 0.6
201 0.69
202 0.77
203 0.84
204 0.82
205 0.84
206 0.83
207 0.84
208 0.8
209 0.75
210 0.7
211 0.61
212 0.55
213 0.46
214 0.38
215 0.29
216 0.26
217 0.29
218 0.26
219 0.27
220 0.31
221 0.32
222 0.38
223 0.42
224 0.44
225 0.39
226 0.42
227 0.47
228 0.44
229 0.44
230 0.37
231 0.33
232 0.27
233 0.24
234 0.17
235 0.1
236 0.08
237 0.06
238 0.06
239 0.04
240 0.03
241 0.03
242 0.03
243 0.03
244 0.03
245 0.04
246 0.04
247 0.06
248 0.08
249 0.09
250 0.1
251 0.14
252 0.16
253 0.19
254 0.26
255 0.27
256 0.26
257 0.29
258 0.35
259 0.33
260 0.33
261 0.34
262 0.31
263 0.34
264 0.34
265 0.32
266 0.26
267 0.26
268 0.24
269 0.2
270 0.16
271 0.11
272 0.1
273 0.09
274 0.08
275 0.06
276 0.07
277 0.07
278 0.07
279 0.09
280 0.12
281 0.13
282 0.14
283 0.14
284 0.14
285 0.16
286 0.16
287 0.16
288 0.17
289 0.21
290 0.22
291 0.28
292 0.3
293 0.28
294 0.28
295 0.27
296 0.26
297 0.28
298 0.26
299 0.19
300 0.18
301 0.2
302 0.2
303 0.19
304 0.17
305 0.17
306 0.18
307 0.22
308 0.3
309 0.31
310 0.36
311 0.45
312 0.54
313 0.58
314 0.68
315 0.74
316 0.75
317 0.8
318 0.82
319 0.81
320 0.72
321 0.68
322 0.6
323 0.51
324 0.41
325 0.36
326 0.32
327 0.27
328 0.29