Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3C533

Protein Details
Accession A0A0C3C533    Localization Confidence Low Confidence Score 9.6
NoLS Segment(s)
PositionSequenceProtein Nature
148-169AVNGCAKKRKVAKKVGNKGGSAHydrophilic
NLS Segment(s)
PositionSequence
154-175KKRKVAKKVGNKGGSASKKQKA
Subcellular Location(s) mito 15.5, cyto_mito 9.833, nucl 6.5, cyto_nucl 5.333, cyto 3
Family & Domain DBs
Amino Acid Sequences MSPTPKSTLQTLLKSSTGTKVQACLLESLGTASDSQIEALVELLAPLSAQAGVKMHCVRCHLTYTENKNHSSACKNKHDDEGNTEYETGNDEGITTLNCCGTSFDSEDSPDTEFCFTAPHTTAEDDVLYYESGNEDEDGVNTNVIRCAVNGCAKKRKVAKKVGNKGGSASKKQKAV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.4
2 0.38
3 0.35
4 0.32
5 0.29
6 0.26
7 0.25
8 0.27
9 0.28
10 0.27
11 0.23
12 0.2
13 0.18
14 0.16
15 0.15
16 0.13
17 0.1
18 0.09
19 0.08
20 0.08
21 0.07
22 0.08
23 0.07
24 0.07
25 0.06
26 0.06
27 0.06
28 0.05
29 0.04
30 0.04
31 0.03
32 0.03
33 0.03
34 0.03
35 0.04
36 0.04
37 0.05
38 0.06
39 0.07
40 0.11
41 0.15
42 0.16
43 0.18
44 0.21
45 0.23
46 0.24
47 0.27
48 0.24
49 0.25
50 0.32
51 0.38
52 0.44
53 0.44
54 0.43
55 0.41
56 0.41
57 0.39
58 0.38
59 0.37
60 0.35
61 0.41
62 0.44
63 0.46
64 0.5
65 0.51
66 0.45
67 0.44
68 0.42
69 0.34
70 0.3
71 0.29
72 0.22
73 0.18
74 0.19
75 0.13
76 0.08
77 0.06
78 0.06
79 0.06
80 0.06
81 0.06
82 0.05
83 0.05
84 0.05
85 0.05
86 0.05
87 0.06
88 0.07
89 0.09
90 0.11
91 0.11
92 0.12
93 0.13
94 0.13
95 0.13
96 0.13
97 0.11
98 0.1
99 0.1
100 0.09
101 0.09
102 0.09
103 0.09
104 0.11
105 0.12
106 0.13
107 0.13
108 0.14
109 0.15
110 0.14
111 0.14
112 0.11
113 0.1
114 0.09
115 0.08
116 0.07
117 0.07
118 0.06
119 0.06
120 0.07
121 0.06
122 0.06
123 0.07
124 0.07
125 0.1
126 0.1
127 0.11
128 0.1
129 0.11
130 0.11
131 0.12
132 0.11
133 0.08
134 0.1
135 0.14
136 0.22
137 0.27
138 0.33
139 0.42
140 0.43
141 0.51
142 0.59
143 0.65
144 0.67
145 0.72
146 0.76
147 0.77
148 0.86
149 0.89
150 0.84
151 0.75
152 0.69
153 0.68
154 0.65
155 0.63
156 0.61