Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3CBG5

Protein Details
Accession A0A0C3CBG5   
Localization Confidence Medium
Confidence Score 13.8
NoLS Segment(s)
PositionSequenceProtein Nature
85-119KVKSQTPKVDKQEKKKTPKGRAKKRILYNRRFVNVHydrophilic
NLS Segment(s)
PositionSequence
85-110KVKSQTPKVDKQEKKKTPKGRAKKRI
Subcellular Location(s) nucl 15, mito 9, cyto 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR006846  Ribosomal_S30  
Gene Ontology GO:1990904  C:ribonucleoprotein complex  
GO:0005840  C:ribosome  
GO:0003735  F:structural constituent of ribosome  
GO:0006412  P:translation  
Pfam View protein in Pfam  
PF04758  Ribosomal_S30  
Amino Acid Sequences MPPWAGALSLWRDAPESRDCCGGNVRNSNLPNCTVSVHFSSSTSSTTATSRQYGKRYDTRPFLCAGTSLTEYRWIVHGSLARAGKVKSQTPKVDKQEKKKTPKGRAKKRILYNRRFVNVTTLPGGKRRM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.23
2 0.27
3 0.26
4 0.25
5 0.3
6 0.3
7 0.3
8 0.37
9 0.38
10 0.37
11 0.41
12 0.43
13 0.44
14 0.46
15 0.46
16 0.41
17 0.37
18 0.31
19 0.25
20 0.24
21 0.18
22 0.19
23 0.19
24 0.19
25 0.17
26 0.17
27 0.17
28 0.17
29 0.17
30 0.14
31 0.13
32 0.11
33 0.12
34 0.14
35 0.15
36 0.16
37 0.2
38 0.24
39 0.28
40 0.3
41 0.34
42 0.4
43 0.41
44 0.44
45 0.47
46 0.45
47 0.42
48 0.4
49 0.35
50 0.27
51 0.23
52 0.19
53 0.13
54 0.13
55 0.12
56 0.11
57 0.13
58 0.13
59 0.13
60 0.14
61 0.12
62 0.11
63 0.12
64 0.15
65 0.12
66 0.17
67 0.17
68 0.17
69 0.18
70 0.18
71 0.2
72 0.21
73 0.26
74 0.27
75 0.34
76 0.42
77 0.46
78 0.55
79 0.6
80 0.67
81 0.69
82 0.73
83 0.77
84 0.79
85 0.82
86 0.83
87 0.84
88 0.84
89 0.88
90 0.89
91 0.89
92 0.9
93 0.91
94 0.91
95 0.91
96 0.92
97 0.91
98 0.89
99 0.88
100 0.86
101 0.8
102 0.72
103 0.62
104 0.6
105 0.52
106 0.47
107 0.41
108 0.36
109 0.33