Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3C882

Protein Details
Accession A0A0C3C882    Localization Confidence Low Confidence Score 7.1
NoLS Segment(s)
PositionSequenceProtein Nature
42-62ESVRNVKKRIRDARPELHNHRBasic
NLS Segment(s)
Subcellular Location(s) plas 13, nucl 6, vacu 3, cyto 2, mito 1, E.R. 1, golg 1, cyto_pero 1
Family & Domain DBs
InterPro View protein in InterPro  
IPR045226  Dsc3  
IPR025390  Dsc3_C  
IPR019413  Dsc3_ub-like_dom  
IPR000626  Ubiquitin-like_dom  
IPR029071  Ubiquitin-like_domsf  
Gene Ontology GO:0044695  C:Dsc E3 ubiquitin ligase complex  
Pfam View protein in Pfam  
PF13373  Dsc3_C  
PF10302  Dsc3_N  
PROSITE View protein in PROSITE  
PS50053  UBIQUITIN_2  
CDD cd17039  Ubl_ubiquitin_like  
Amino Acid Sequences MLSERAKGKQRATVDDEHSSRELVVRFTEGAPDLTISVNKAESVRNVKKRIRDARPELHNHRLRLIHSGRLLTDGTPLLNSLNEQRENHDDRSSSTKPTTTWIHCSVGPLIAGELEDDKNTQTAQIQPIRGFDRLASVGFSPEDIENFRRQFHSQSSSNYLDLDFETEEEYDEHARSLEEQWIDSIDNAGSATLSQAGGASTAVLQGVLMGFFFPLIPFFFMWNRKPAVFWEDNSEQEPTSNVIFSRRMSMGLVVGFLVNILFGMWRFLLDSS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.55
2 0.57
3 0.55
4 0.52
5 0.48
6 0.4
7 0.34
8 0.3
9 0.26
10 0.19
11 0.2
12 0.18
13 0.19
14 0.18
15 0.21
16 0.18
17 0.18
18 0.16
19 0.15
20 0.14
21 0.13
22 0.14
23 0.12
24 0.12
25 0.11
26 0.12
27 0.12
28 0.13
29 0.18
30 0.28
31 0.36
32 0.43
33 0.51
34 0.55
35 0.62
36 0.7
37 0.75
38 0.74
39 0.75
40 0.75
41 0.76
42 0.8
43 0.81
44 0.78
45 0.78
46 0.74
47 0.65
48 0.61
49 0.55
50 0.47
51 0.47
52 0.43
53 0.38
54 0.35
55 0.35
56 0.3
57 0.29
58 0.29
59 0.2
60 0.2
61 0.14
62 0.12
63 0.11
64 0.11
65 0.09
66 0.08
67 0.09
68 0.11
69 0.16
70 0.19
71 0.2
72 0.23
73 0.3
74 0.35
75 0.36
76 0.34
77 0.29
78 0.28
79 0.36
80 0.34
81 0.31
82 0.27
83 0.27
84 0.24
85 0.28
86 0.32
87 0.27
88 0.31
89 0.31
90 0.32
91 0.31
92 0.32
93 0.28
94 0.23
95 0.2
96 0.14
97 0.1
98 0.08
99 0.07
100 0.06
101 0.06
102 0.05
103 0.06
104 0.06
105 0.06
106 0.06
107 0.06
108 0.06
109 0.06
110 0.09
111 0.14
112 0.18
113 0.19
114 0.19
115 0.22
116 0.24
117 0.23
118 0.21
119 0.15
120 0.14
121 0.13
122 0.13
123 0.11
124 0.09
125 0.09
126 0.09
127 0.09
128 0.07
129 0.06
130 0.07
131 0.08
132 0.1
133 0.14
134 0.15
135 0.16
136 0.17
137 0.18
138 0.2
139 0.23
140 0.27
141 0.25
142 0.28
143 0.33
144 0.33
145 0.32
146 0.29
147 0.25
148 0.19
149 0.17
150 0.15
151 0.09
152 0.07
153 0.08
154 0.07
155 0.08
156 0.08
157 0.09
158 0.08
159 0.08
160 0.08
161 0.08
162 0.08
163 0.08
164 0.1
165 0.12
166 0.11
167 0.11
168 0.12
169 0.12
170 0.13
171 0.11
172 0.11
173 0.07
174 0.06
175 0.06
176 0.06
177 0.05
178 0.04
179 0.05
180 0.05
181 0.05
182 0.04
183 0.05
184 0.05
185 0.05
186 0.05
187 0.05
188 0.04
189 0.04
190 0.04
191 0.04
192 0.03
193 0.03
194 0.04
195 0.03
196 0.03
197 0.03
198 0.03
199 0.03
200 0.04
201 0.03
202 0.05
203 0.06
204 0.07
205 0.08
206 0.11
207 0.16
208 0.22
209 0.24
210 0.28
211 0.3
212 0.29
213 0.3
214 0.3
215 0.34
216 0.32
217 0.3
218 0.34
219 0.34
220 0.35
221 0.36
222 0.35
223 0.26
224 0.23
225 0.23
226 0.17
227 0.15
228 0.14
229 0.13
230 0.15
231 0.18
232 0.19
233 0.23
234 0.21
235 0.21
236 0.21
237 0.22
238 0.2
239 0.18
240 0.18
241 0.12
242 0.12
243 0.1
244 0.09
245 0.07
246 0.04
247 0.04
248 0.04
249 0.04
250 0.04
251 0.07
252 0.07
253 0.07