Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3CJL4

Protein Details
Accession A0A0C3CJL4    Localization Confidence Low Confidence Score 9.8
NoLS Segment(s)
PositionSequenceProtein Nature
13-40SSSNIQRTDSRKRPRNNQQRKHTVYNTNHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 12, mito 6, plas 5, cyto 2
Family & Domain DBs
Amino Acid Sequences MGFRRDNKRRRFSSSNIQRTDSRKRPRNNQQRKHTVYNTNLNLDGEESVAVAAHKPPGVEVVAGSMAGLGESLAVVVGIGVAVSNEGCKPAQVPPVRNSPGVST
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.78
2 0.78
3 0.71
4 0.69
5 0.65
6 0.64
7 0.68
8 0.66
9 0.66
10 0.64
11 0.69
12 0.75
13 0.81
14 0.86
15 0.87
16 0.88
17 0.88
18 0.89
19 0.88
20 0.86
21 0.81
22 0.78
23 0.72
24 0.71
25 0.63
26 0.54
27 0.48
28 0.39
29 0.33
30 0.25
31 0.19
32 0.1
33 0.07
34 0.05
35 0.04
36 0.04
37 0.04
38 0.04
39 0.04
40 0.05
41 0.05
42 0.05
43 0.05
44 0.06
45 0.07
46 0.07
47 0.06
48 0.07
49 0.06
50 0.06
51 0.06
52 0.04
53 0.04
54 0.04
55 0.04
56 0.02
57 0.02
58 0.02
59 0.02
60 0.02
61 0.02
62 0.02
63 0.02
64 0.02
65 0.02
66 0.02
67 0.02
68 0.02
69 0.02
70 0.02
71 0.04
72 0.04
73 0.06
74 0.06
75 0.07
76 0.09
77 0.13
78 0.22
79 0.28
80 0.33
81 0.36
82 0.47
83 0.5
84 0.5