Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3CB11

Protein Details
Accession A0A0C3CB11    Localization Confidence Medium Confidence Score 11
NoLS Segment(s)
PositionSequenceProtein Nature
21-49YSTAFQTRDSRRKKLKWRRAMMNGKKKVQHydrophilic
NLS Segment(s)
PositionSequence
30-50SRRKKLKWRRAMMNGKKKVQR
Subcellular Location(s) mito 14mito_nucl 14, nucl 12
Family & Domain DBs
Amino Acid Sequences MTGSFLPYKMTLSSRRRTPNYSTAFQTRDSRRKKLKWRRAMMNGKKKVQRPMPNKLDNNWTPVIFCYSAPGCKFPTQHYVGGLNVCTTGTNVSTATPGSALSSLNKPNFTLHT
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.49
2 0.57
3 0.6
4 0.63
5 0.66
6 0.66
7 0.65
8 0.61
9 0.58
10 0.54
11 0.51
12 0.49
13 0.51
14 0.5
15 0.53
16 0.55
17 0.59
18 0.63
19 0.7
20 0.78
21 0.8
22 0.82
23 0.83
24 0.86
25 0.86
26 0.87
27 0.89
28 0.88
29 0.87
30 0.84
31 0.8
32 0.77
33 0.72
34 0.69
35 0.67
36 0.66
37 0.62
38 0.65
39 0.67
40 0.7
41 0.67
42 0.61
43 0.61
44 0.51
45 0.49
46 0.4
47 0.31
48 0.23
49 0.22
50 0.23
51 0.15
52 0.14
53 0.13
54 0.13
55 0.16
56 0.17
57 0.18
58 0.18
59 0.21
60 0.23
61 0.22
62 0.29
63 0.29
64 0.3
65 0.3
66 0.29
67 0.27
68 0.27
69 0.24
70 0.17
71 0.13
72 0.12
73 0.09
74 0.08
75 0.08
76 0.07
77 0.08
78 0.08
79 0.08
80 0.09
81 0.09
82 0.09
83 0.08
84 0.08
85 0.08
86 0.09
87 0.09
88 0.12
89 0.17
90 0.24
91 0.27
92 0.28
93 0.28