Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3CA06

Protein Details
Accession A0A0C3CA06   
Localization Confidence Medium
Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
4-33QEGPQVNGKDRSKRKRRSRLKNEREWGRGRBasic
NLS Segment(s)
PositionSequence
12-36KDRSKRKRRSRLKNEREWGRGRILK
Subcellular Location(s) nucl 25, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MKRQEGPQVNGKDRSKRKRRSRLKNEREWGRGRILKVRNNNNKIVHTPEAAREEREPDSQTTHSPLSSVSPMIAGNGHRLPRSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.74
2 0.75
3 0.77
4 0.83
5 0.85
6 0.91
7 0.93
8 0.94
9 0.94
10 0.94
11 0.94
12 0.92
13 0.89
14 0.85
15 0.78
16 0.69
17 0.65
18 0.59
19 0.49
20 0.49
21 0.46
22 0.46
23 0.5
24 0.57
25 0.6
26 0.6
27 0.64
28 0.58
29 0.54
30 0.5
31 0.47
32 0.38
33 0.29
34 0.26
35 0.24
36 0.27
37 0.25
38 0.25
39 0.21
40 0.23
41 0.24
42 0.26
43 0.24
44 0.2
45 0.24
46 0.23
47 0.24
48 0.25
49 0.23
50 0.2
51 0.18
52 0.17
53 0.17
54 0.17
55 0.16
56 0.12
57 0.12
58 0.12
59 0.12
60 0.14
61 0.11
62 0.15
63 0.2
64 0.23