Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C2XBK2

Protein Details
Accession A0A0C2XBK2    Localization Confidence Low Confidence Score 9.3
NoLS Segment(s)
PositionSequenceProtein Nature
30-70GPKVRDEGRKKGKQKKPHETKVKMTTLRKGSKCKRRVIGRGBasic
NLS Segment(s)
PositionSequence
33-70VRDEGRKKGKQKKPHETKVKMTTLRKGSKCKRRVIGRG
Subcellular Location(s) mito 19, nucl 4, cyto 4, cyto_nucl 4
Family & Domain DBs
Amino Acid Sequences MRIRIHGRPSTIYVLWCALVGHRLDVEATGPKVRDEGRKKGKQKKPHETKVKMTTLRKGSKCKRRVIGRG
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.27
2 0.23
3 0.2
4 0.15
5 0.1
6 0.12
7 0.12
8 0.11
9 0.09
10 0.09
11 0.09
12 0.09
13 0.1
14 0.09
15 0.09
16 0.1
17 0.11
18 0.1
19 0.12
20 0.14
21 0.22
22 0.25
23 0.34
24 0.43
25 0.51
26 0.6
27 0.69
28 0.75
29 0.77
30 0.82
31 0.84
32 0.84
33 0.86
34 0.88
35 0.84
36 0.85
37 0.83
38 0.81
39 0.78
40 0.71
41 0.69
42 0.68
43 0.71
44 0.68
45 0.7
46 0.71
47 0.74
48 0.78
49 0.79
50 0.79