Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2YBR0

Protein Details
Accession A0A0C2YBR0   
Localization Confidence Low
Confidence Score 6.2
NoLS Segment(s)
PositionSequenceProtein Nature
26-51KKTHVWRCCRTRCMKRSRPNVRFHTRHydrophilic
NLS Segment(s)
Subcellular Location(s) mito 23, nucl 3
Family & Domain DBs
Amino Acid Sequences MMVRKAGPITVLYIFKTFYIIKQERKKTHVWRCCRTRCMKRSRPNVRFHTRGCDISKPLFGTRLLTLPPQISPNTSLHNRLR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.18
2 0.17
3 0.19
4 0.16
5 0.15
6 0.23
7 0.27
8 0.35
9 0.44
10 0.54
11 0.56
12 0.6
13 0.66
14 0.66
15 0.72
16 0.71
17 0.71
18 0.71
19 0.76
20 0.79
21 0.79
22 0.78
23 0.78
24 0.78
25 0.8
26 0.8
27 0.8
28 0.83
29 0.86
30 0.85
31 0.83
32 0.83
33 0.8
34 0.76
35 0.68
36 0.65
37 0.57
38 0.54
39 0.48
40 0.43
41 0.39
42 0.36
43 0.37
44 0.32
45 0.3
46 0.27
47 0.24
48 0.23
49 0.21
50 0.21
51 0.19
52 0.18
53 0.19
54 0.18
55 0.19
56 0.19
57 0.19
58 0.19
59 0.21
60 0.22
61 0.28
62 0.3