Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2Y261

Protein Details
Accession A0A0C2Y261    Localization Confidence Low Confidence Score 7.9
NoLS Segment(s)
PositionSequenceProtein Nature
74-96LVDRKAIREHKRKYPPMPGSKPNBasic
NLS Segment(s)
Subcellular Location(s) cyto_nucl 11, nucl 10, cyto 10, pero 4
Family & Domain DBs
InterPro View protein in InterPro  
IPR011008  Dimeric_a/b-barrel  
IPR006314  Dyp_peroxidase  
Gene Ontology GO:0020037  F:heme binding  
GO:0004601  F:peroxidase activity  
Pfam View protein in Pfam  
PF04261  Dyp_perox  
PROSITE View protein in PROSITE  
PS51404  DYP_PEROXIDASE  
Amino Acid Sequences MTTPQQPLLPVVQPPPGSPPRLDSLKLDNIQGDVLAGLPKKTETLYFFVITDTDKFRHDLRSFNPLVKTVAQVLVDRKAIREHKRKYPPMPGSKPNLIPLVGVNIAFSHFGFKKLGIDDKKLADPAFLAGQRADAEGLHDKGTGTGPSFVPDWEQPFKSEIHGVFLLAGDSRATVDKKLQEIKTIFGVGGPKPSLKEITSVRGDARPGAQSAHEHFGYLDGISNPAIKGFAPDANPPPGPAPIDAGVIVTGHPGDEKQNDREDWQVDGSFLVFRYLFQKVPEFNNFVFENRLKGPGLTDQEGADLLGARLIGRWKSGAPLDITPFIDDPKIGTDPNENNNFHFTAETEVQKLCPFAAHVRKTLPRADLEDRPGNPSIARFRIMRRGIQFGPEVTEKEKMAKKTSHGRGLIFICYQSSIANGFQFIQKNWVDNPNFPPGAPPTQRPGVDPILGQGPGRDKISGHNPNKPTDTLELTDEWIIPRGGEYFFTPSLKGLRERIAA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.3
2 0.36
3 0.37
4 0.37
5 0.35
6 0.36
7 0.37
8 0.41
9 0.42
10 0.38
11 0.4
12 0.46
13 0.47
14 0.44
15 0.38
16 0.34
17 0.32
18 0.28
19 0.2
20 0.1
21 0.09
22 0.11
23 0.11
24 0.1
25 0.11
26 0.12
27 0.13
28 0.14
29 0.17
30 0.17
31 0.22
32 0.26
33 0.26
34 0.26
35 0.25
36 0.25
37 0.23
38 0.22
39 0.22
40 0.19
41 0.19
42 0.21
43 0.23
44 0.32
45 0.32
46 0.36
47 0.35
48 0.43
49 0.44
50 0.47
51 0.47
52 0.39
53 0.41
54 0.35
55 0.34
56 0.27
57 0.28
58 0.24
59 0.24
60 0.25
61 0.26
62 0.29
63 0.27
64 0.25
65 0.3
66 0.37
67 0.45
68 0.52
69 0.55
70 0.62
71 0.72
72 0.8
73 0.79
74 0.81
75 0.81
76 0.81
77 0.82
78 0.79
79 0.76
80 0.75
81 0.7
82 0.63
83 0.55
84 0.44
85 0.37
86 0.29
87 0.26
88 0.2
89 0.17
90 0.14
91 0.11
92 0.12
93 0.12
94 0.11
95 0.12
96 0.12
97 0.14
98 0.15
99 0.15
100 0.18
101 0.21
102 0.29
103 0.27
104 0.32
105 0.34
106 0.36
107 0.38
108 0.36
109 0.34
110 0.25
111 0.22
112 0.18
113 0.19
114 0.16
115 0.15
116 0.13
117 0.14
118 0.14
119 0.14
120 0.13
121 0.08
122 0.1
123 0.13
124 0.15
125 0.14
126 0.14
127 0.13
128 0.14
129 0.16
130 0.13
131 0.11
132 0.13
133 0.12
134 0.13
135 0.14
136 0.13
137 0.14
138 0.15
139 0.19
140 0.2
141 0.21
142 0.21
143 0.22
144 0.23
145 0.22
146 0.24
147 0.19
148 0.19
149 0.19
150 0.17
151 0.16
152 0.15
153 0.14
154 0.09
155 0.09
156 0.05
157 0.05
158 0.05
159 0.07
160 0.08
161 0.09
162 0.13
163 0.16
164 0.2
165 0.28
166 0.27
167 0.32
168 0.32
169 0.33
170 0.31
171 0.28
172 0.24
173 0.18
174 0.2
175 0.13
176 0.16
177 0.15
178 0.14
179 0.14
180 0.16
181 0.16
182 0.14
183 0.18
184 0.16
185 0.22
186 0.23
187 0.23
188 0.23
189 0.23
190 0.23
191 0.19
192 0.19
193 0.15
194 0.13
195 0.13
196 0.13
197 0.13
198 0.16
199 0.18
200 0.16
201 0.15
202 0.14
203 0.14
204 0.14
205 0.12
206 0.1
207 0.06
208 0.07
209 0.07
210 0.08
211 0.07
212 0.06
213 0.07
214 0.05
215 0.06
216 0.07
217 0.1
218 0.11
219 0.13
220 0.16
221 0.19
222 0.19
223 0.18
224 0.17
225 0.16
226 0.15
227 0.13
228 0.12
229 0.1
230 0.1
231 0.1
232 0.09
233 0.08
234 0.07
235 0.06
236 0.05
237 0.04
238 0.03
239 0.03
240 0.03
241 0.05
242 0.09
243 0.12
244 0.14
245 0.18
246 0.19
247 0.2
248 0.23
249 0.22
250 0.2
251 0.18
252 0.15
253 0.12
254 0.11
255 0.11
256 0.08
257 0.07
258 0.07
259 0.06
260 0.06
261 0.09
262 0.11
263 0.11
264 0.12
265 0.15
266 0.16
267 0.21
268 0.24
269 0.25
270 0.23
271 0.26
272 0.26
273 0.23
274 0.25
275 0.21
276 0.2
277 0.18
278 0.2
279 0.16
280 0.15
281 0.16
282 0.17
283 0.21
284 0.19
285 0.19
286 0.17
287 0.17
288 0.17
289 0.15
290 0.1
291 0.07
292 0.05
293 0.04
294 0.04
295 0.04
296 0.05
297 0.07
298 0.08
299 0.08
300 0.09
301 0.09
302 0.11
303 0.12
304 0.14
305 0.14
306 0.16
307 0.18
308 0.2
309 0.2
310 0.18
311 0.18
312 0.16
313 0.14
314 0.11
315 0.1
316 0.1
317 0.11
318 0.1
319 0.11
320 0.17
321 0.21
322 0.28
323 0.35
324 0.32
325 0.32
326 0.35
327 0.34
328 0.28
329 0.24
330 0.18
331 0.15
332 0.18
333 0.18
334 0.17
335 0.16
336 0.17
337 0.17
338 0.17
339 0.12
340 0.1
341 0.11
342 0.16
343 0.26
344 0.28
345 0.3
346 0.35
347 0.4
348 0.42
349 0.45
350 0.4
351 0.33
352 0.36
353 0.39
354 0.39
355 0.41
356 0.44
357 0.41
358 0.42
359 0.4
360 0.35
361 0.3
362 0.29
363 0.29
364 0.25
365 0.27
366 0.25
367 0.27
368 0.36
369 0.39
370 0.41
371 0.38
372 0.42
373 0.4
374 0.42
375 0.4
376 0.3
377 0.32
378 0.28
379 0.26
380 0.22
381 0.24
382 0.21
383 0.26
384 0.31
385 0.3
386 0.35
387 0.37
388 0.41
389 0.48
390 0.56
391 0.58
392 0.55
393 0.53
394 0.52
395 0.51
396 0.48
397 0.38
398 0.31
399 0.23
400 0.21
401 0.2
402 0.13
403 0.12
404 0.11
405 0.12
406 0.12
407 0.12
408 0.12
409 0.16
410 0.19
411 0.18
412 0.23
413 0.23
414 0.25
415 0.27
416 0.35
417 0.33
418 0.35
419 0.4
420 0.42
421 0.41
422 0.38
423 0.39
424 0.35
425 0.41
426 0.4
427 0.39
428 0.37
429 0.43
430 0.44
431 0.42
432 0.43
433 0.38
434 0.37
435 0.33
436 0.29
437 0.26
438 0.26
439 0.24
440 0.21
441 0.21
442 0.22
443 0.24
444 0.22
445 0.19
446 0.25
447 0.35
448 0.43
449 0.44
450 0.5
451 0.52
452 0.57
453 0.61
454 0.56
455 0.49
456 0.44
457 0.43
458 0.36
459 0.36
460 0.31
461 0.29
462 0.3
463 0.26
464 0.22
465 0.2
466 0.18
467 0.14
468 0.14
469 0.14
470 0.13
471 0.14
472 0.15
473 0.19
474 0.21
475 0.23
476 0.22
477 0.23
478 0.27
479 0.3
480 0.32
481 0.31