Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3CIG3

Protein Details
Accession A0A0C3CIG3   
Localization Confidence Medium
Confidence Score 12.5
NoLS Segment(s)
PositionSequenceProtein Nature
11-38GRKASSRKYFVPRARRPKYKQRSANLELHydrophilic
NLS Segment(s)
PositionSequence
11-30GRKASSRKYFVPRARRPKYK
Subcellular Location(s) nucl 16.5, cyto_nucl 12, cyto 6.5, mito 2
Family & Domain DBs
InterPro View protein in InterPro  
IPR004875  DDE_SF_endonuclease_dom  
Gene Ontology GO:0003676  F:nucleic acid binding  
Pfam View protein in Pfam  
PF03184  DDE_1  
Amino Acid Sequences MDEKGCQRGGGRKASSRKYFVPRARRPKYKQRSANLELVTIIECVCADGTNLKPGFVFQGKEFSPEWFDVDDDISVSMSENGWTDDFLCSEWFTHSFIPQATARNSSKKPILLV
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.64
2 0.67
3 0.64
4 0.66
5 0.65
6 0.69
7 0.7
8 0.72
9 0.73
10 0.78
11 0.82
12 0.84
13 0.84
14 0.86
15 0.88
16 0.87
17 0.86
18 0.83
19 0.83
20 0.78
21 0.77
22 0.66
23 0.56
24 0.46
25 0.37
26 0.29
27 0.19
28 0.14
29 0.06
30 0.06
31 0.05
32 0.05
33 0.04
34 0.04
35 0.06
36 0.07
37 0.13
38 0.13
39 0.13
40 0.13
41 0.13
42 0.16
43 0.15
44 0.16
45 0.1
46 0.15
47 0.15
48 0.18
49 0.18
50 0.16
51 0.17
52 0.16
53 0.17
54 0.12
55 0.13
56 0.1
57 0.11
58 0.1
59 0.07
60 0.07
61 0.06
62 0.05
63 0.06
64 0.05
65 0.05
66 0.05
67 0.06
68 0.07
69 0.07
70 0.07
71 0.08
72 0.08
73 0.08
74 0.09
75 0.09
76 0.09
77 0.09
78 0.12
79 0.12
80 0.13
81 0.14
82 0.15
83 0.16
84 0.16
85 0.19
86 0.19
87 0.24
88 0.24
89 0.3
90 0.33
91 0.39
92 0.41
93 0.43
94 0.47