Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3C7X3

Protein Details
Accession A0A0C3C7X3    Localization Confidence Low Confidence Score 9
NoLS Segment(s)
PositionSequenceProtein Nature
64-88QAYRDCKSTWIKQRKEDRRAGRPTSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 14.5, cyto_nucl 10, cyto 4.5, mito 4, pero 3
Family & Domain DBs
InterPro View protein in InterPro  
IPR009069  Cys_alpha_HP_mot_SF  
PROSITE View protein in PROSITE  
PS51808  CHCH  
Amino Acid Sequences MSKQKSEPIPAPEDNIKPLNYREQFAGREVTSKFVDPCAAASKASMDCMTRNDYDRDACLEYFQAYRDCKSTWIKQRKEDRRAGRPTS
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.43
2 0.4
3 0.34
4 0.3
5 0.31
6 0.36
7 0.32
8 0.32
9 0.3
10 0.32
11 0.32
12 0.31
13 0.33
14 0.23
15 0.25
16 0.24
17 0.24
18 0.21
19 0.2
20 0.19
21 0.16
22 0.16
23 0.12
24 0.13
25 0.14
26 0.13
27 0.12
28 0.11
29 0.13
30 0.12
31 0.13
32 0.12
33 0.08
34 0.09
35 0.11
36 0.14
37 0.14
38 0.16
39 0.17
40 0.18
41 0.19
42 0.19
43 0.2
44 0.19
45 0.17
46 0.16
47 0.15
48 0.14
49 0.14
50 0.15
51 0.16
52 0.16
53 0.18
54 0.19
55 0.19
56 0.23
57 0.29
58 0.37
59 0.43
60 0.52
61 0.57
62 0.64
63 0.75
64 0.8
65 0.83
66 0.83
67 0.82
68 0.82