Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C2Y7K8

Protein Details
Accession A0A0C2Y7K8    Localization Confidence Medium Confidence Score 10.3
NoLS Segment(s)
PositionSequenceProtein Nature
91-114EMDISRSRRLRRRGIRDFRAQSSRHydrophilic
NLS Segment(s)
PositionSequence
101-103RRR
Subcellular Location(s) nucl 7extr 7cyto_nucl 7, mito 5, cyto 5
Family & Domain DBs
InterPro View protein in InterPro  
IPR045340  DUF6533  
Pfam View protein in Pfam  
PF20151  DUF6533  
Amino Acid Sequences MHASLGLRALNANGATSSDPYAGDDYLVHFCQVAALVITLYDHLITLDREVEYSWSRRWSKSKALFILARYFGDLLLITDCFVFLNRDAVEMDISRSRRLRRRGIRDFRAQSSRVRNACP
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.11
2 0.12
3 0.13
4 0.14
5 0.11
6 0.11
7 0.12
8 0.14
9 0.12
10 0.11
11 0.1
12 0.11
13 0.14
14 0.14
15 0.13
16 0.11
17 0.11
18 0.11
19 0.11
20 0.09
21 0.05
22 0.05
23 0.05
24 0.05
25 0.05
26 0.05
27 0.04
28 0.04
29 0.03
30 0.04
31 0.05
32 0.05
33 0.06
34 0.07
35 0.06
36 0.07
37 0.07
38 0.09
39 0.1
40 0.12
41 0.13
42 0.19
43 0.21
44 0.24
45 0.29
46 0.31
47 0.39
48 0.44
49 0.49
50 0.44
51 0.47
52 0.45
53 0.43
54 0.43
55 0.34
56 0.27
57 0.21
58 0.18
59 0.14
60 0.12
61 0.11
62 0.06
63 0.06
64 0.06
65 0.06
66 0.05
67 0.06
68 0.05
69 0.06
70 0.07
71 0.06
72 0.1
73 0.1
74 0.11
75 0.12
76 0.12
77 0.13
78 0.12
79 0.14
80 0.16
81 0.17
82 0.21
83 0.25
84 0.32
85 0.39
86 0.47
87 0.55
88 0.61
89 0.7
90 0.77
91 0.83
92 0.84
93 0.86
94 0.85
95 0.82
96 0.78
97 0.69
98 0.66
99 0.65
100 0.66