Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3BZN1

Protein Details
Accession A0A0C3BZN1    Localization Confidence Medium Confidence Score 11.1
NoLS Segment(s)
PositionSequenceProtein Nature
37-56KERSRHSRLGRKQNKVNAKSBasic
NLS Segment(s)
PositionSequence
27-57GRIKRIGKCGKERSRHSRLGRKQNKVNAKSR
Subcellular Location(s) nucl 11.5, cyto_nucl 10, mito 8, cyto 7.5
Family & Domain DBs
Amino Acid Sequences MSEISEAVPGSGKTCGKMALLAGTPPGRIKRIGKCGKERSRHSRLGRKQNKVNAKSRMAHPTKLRNCIPDAI
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.16
2 0.16
3 0.15
4 0.15
5 0.15
6 0.13
7 0.13
8 0.12
9 0.14
10 0.13
11 0.13
12 0.15
13 0.16
14 0.14
15 0.16
16 0.21
17 0.26
18 0.36
19 0.44
20 0.47
21 0.55
22 0.64
23 0.69
24 0.73
25 0.73
26 0.71
27 0.71
28 0.74
29 0.72
30 0.72
31 0.73
32 0.76
33 0.78
34 0.78
35 0.78
36 0.77
37 0.8
38 0.77
39 0.76
40 0.73
41 0.7
42 0.67
43 0.64
44 0.66
45 0.6
46 0.6
47 0.59
48 0.62
49 0.63
50 0.67
51 0.65
52 0.58