Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C2Y7F8

Protein Details
Accession A0A0C2Y7F8    Localization Confidence Low Confidence Score 9.4
NoLS Segment(s)
PositionSequenceProtein Nature
66-87AGTNITSRAERKKKNTRCWKKAHydrophilic
NLS Segment(s)
PositionSequence
77-79KKK
Subcellular Location(s) mito 19.5, mito_nucl 13, nucl 5.5
Family & Domain DBs
Amino Acid Sequences MASSRRDMHRGIHYHPINIYILIYNRDYAELQPWPPRGMDRFNTTQSLTYHSDPKKNDSTPCSVVAGTNITSRAERKKKNTRCWKKA
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.44
3 0.4
4 0.31
5 0.27
6 0.24
7 0.15
8 0.16
9 0.16
10 0.16
11 0.14
12 0.13
13 0.14
14 0.14
15 0.12
16 0.14
17 0.14
18 0.16
19 0.2
20 0.21
21 0.21
22 0.2
23 0.22
24 0.21
25 0.23
26 0.24
27 0.24
28 0.27
29 0.28
30 0.29
31 0.28
32 0.28
33 0.24
34 0.26
35 0.24
36 0.22
37 0.28
38 0.29
39 0.34
40 0.32
41 0.37
42 0.39
43 0.39
44 0.42
45 0.38
46 0.42
47 0.4
48 0.4
49 0.36
50 0.3
51 0.27
52 0.23
53 0.22
54 0.16
55 0.15
56 0.14
57 0.14
58 0.15
59 0.19
60 0.28
61 0.35
62 0.42
63 0.51
64 0.61
65 0.7
66 0.8
67 0.88