Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3CXA5

Protein Details
Accession A0A0C3CXA5    Localization Confidence Medium Confidence Score 11.3
NoLS Segment(s)
PositionSequenceProtein Nature
1-26MTFHKEDNERRRRPSQRRPPQSQLVSHydrophilic
NLS Segment(s)
Subcellular Location(s) nucl 23.5, cyto_nucl 14
Family & Domain DBs
Amino Acid Sequences MTFHKEDNERRRRPSQRRPPQSQLVSGQSKVFDGLPEIGGNHEIDGSTCDGSK
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.84
2 0.84
3 0.85
4 0.88
5 0.9
6 0.87
7 0.86
8 0.78
9 0.71
10 0.63
11 0.59
12 0.51
13 0.42
14 0.35
15 0.26
16 0.23
17 0.2
18 0.16
19 0.09
20 0.08
21 0.09
22 0.09
23 0.09
24 0.09
25 0.09
26 0.1
27 0.1
28 0.08
29 0.07
30 0.07
31 0.07
32 0.09
33 0.1