Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3CT62

Protein Details
Accession A0A0C3CT62    Localization Confidence High Confidence Score 20.5
NoLS Segment(s)
PositionSequenceProtein Nature
13-38MVPTQEYPTKKKKRRTVEGEKNNFHDHydrophilic
79-111AASPISSRQKKRQTRTPSTRRSNRKEKVYDTQLHydrophilic
NLS Segment(s)
PositionSequence
22-27KKKKRR
45-49KKEKH
87-100QKKRQTRTPSTRRS
Subcellular Location(s) nucl 23.5, cyto_nucl 12.5
Family & Domain DBs
Amino Acid Sequences MMREGNEYRRRNMVPTQEYPTKKKKRRTVEGEKNNFHDCPLVEKKKEKHKEMAKSTRQGGPHDANLISGWAGQGPSKLAASPISSRQKKRQTRTPSTRRSNRKEKVYDTQL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.5
2 0.52
3 0.56
4 0.57
5 0.6
6 0.63
7 0.66
8 0.67
9 0.68
10 0.73
11 0.75
12 0.77
13 0.83
14 0.86
15 0.87
16 0.87
17 0.9
18 0.89
19 0.84
20 0.77
21 0.69
22 0.59
23 0.48
24 0.39
25 0.28
26 0.26
27 0.32
28 0.34
29 0.34
30 0.41
31 0.46
32 0.55
33 0.62
34 0.59
35 0.59
36 0.61
37 0.67
38 0.7
39 0.75
40 0.7
41 0.66
42 0.65
43 0.59
44 0.53
45 0.45
46 0.4
47 0.32
48 0.27
49 0.25
50 0.22
51 0.19
52 0.17
53 0.16
54 0.1
55 0.08
56 0.06
57 0.05
58 0.05
59 0.05
60 0.05
61 0.06
62 0.07
63 0.07
64 0.07
65 0.08
66 0.09
67 0.12
68 0.14
69 0.22
70 0.31
71 0.38
72 0.43
73 0.52
74 0.62
75 0.69
76 0.74
77 0.76
78 0.76
79 0.81
80 0.87
81 0.88
82 0.88
83 0.89
84 0.91
85 0.92
86 0.91
87 0.9
88 0.88
89 0.88
90 0.85
91 0.82