Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3BRW8

Protein Details
Accession A0A0C3BRW8    Localization Confidence Medium Confidence Score 10.2
NoLS Segment(s)
PositionSequenceProtein Nature
2-35TLRATKGFKARRRGWGRKGKLMRRWKLNKIRRSLBasic
NLS Segment(s)
PositionSequence
7-33KGFKARRRGWGRKGKLMRRWKLNKIRR
Subcellular Location(s) mito 13.5, mito_nucl 11.833, nucl 9, cyto_nucl 6.833
Family & Domain DBs
Amino Acid Sequences MTLRATKGFKARRRGWGRKGKLMRRWKLNKIRRSLSVANCHHRQPGIPCKGWPVFTLPNSVGISSPSAIAIIVEMVSSISRCRGR
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.8
2 0.81
3 0.82
4 0.82
5 0.82
6 0.85
7 0.83
8 0.83
9 0.84
10 0.81
11 0.81
12 0.82
13 0.82
14 0.82
15 0.83
16 0.8
17 0.78
18 0.74
19 0.67
20 0.67
21 0.63
22 0.59
23 0.59
24 0.57
25 0.55
26 0.53
27 0.5
28 0.43
29 0.37
30 0.32
31 0.28
32 0.33
33 0.33
34 0.32
35 0.31
36 0.36
37 0.37
38 0.37
39 0.31
40 0.27
41 0.26
42 0.25
43 0.29
44 0.24
45 0.28
46 0.27
47 0.26
48 0.2
49 0.16
50 0.17
51 0.13
52 0.13
53 0.08
54 0.08
55 0.07
56 0.07
57 0.06
58 0.05
59 0.04
60 0.04
61 0.04
62 0.04
63 0.05
64 0.06
65 0.06