Nucleolar Localized Proteins

Nucleolar localized proteins available in the database.

A0A0C3BSU5

Protein Details
Accession A0A0C3BSU5    Localization Confidence Medium Confidence Score 14.4
NoLS Segment(s)
PositionSequenceProtein Nature
75-105AHRRNANETPKKTQRPKRPTRAKTPKGVESEHydrophilic
NLS Segment(s)
PositionSequence
84-100PKKTQRPKRPTRAKTPK
Subcellular Location(s) nucl 24.5, cyto_nucl 13.5
Family & Domain DBs
Amino Acid Sequences MCFDRKVVNATPNPSHSDLAENDLDTTVSFAKQNVENVDAICKAARERFSVLKKYAASWPVRDILKLHLKYTSEAHRRNANETPKKTQRPKRPTRAKTPKGVESEDSM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.46
2 0.42
3 0.34
4 0.33
5 0.28
6 0.27
7 0.25
8 0.2
9 0.18
10 0.17
11 0.17
12 0.12
13 0.13
14 0.08
15 0.08
16 0.08
17 0.08
18 0.11
19 0.13
20 0.16
21 0.16
22 0.17
23 0.17
24 0.17
25 0.18
26 0.16
27 0.14
28 0.11
29 0.1
30 0.09
31 0.12
32 0.13
33 0.14
34 0.17
35 0.23
36 0.28
37 0.33
38 0.33
39 0.34
40 0.32
41 0.32
42 0.32
43 0.3
44 0.27
45 0.23
46 0.24
47 0.24
48 0.24
49 0.23
50 0.2
51 0.21
52 0.29
53 0.29
54 0.27
55 0.26
56 0.27
57 0.28
58 0.31
59 0.35
60 0.34
61 0.37
62 0.41
63 0.45
64 0.45
65 0.49
66 0.52
67 0.53
68 0.54
69 0.56
70 0.61
71 0.64
72 0.72
73 0.77
74 0.8
75 0.8
76 0.82
77 0.88
78 0.89
79 0.91
80 0.9
81 0.91
82 0.93
83 0.89
84 0.89
85 0.85
86 0.82
87 0.77
88 0.72