Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C3C1U2

Protein Details
Accession A0A0C3C1U2   
Localization Confidence Medium
Confidence Score 10.7
NoLS Segment(s)
PositionSequenceProtein Nature
59-91DVAKECPREENTRRRRRRRRRKRKRKGTQGYPLBasic
NLS Segment(s)
PositionSequence
71-85RRRRRRRRRKRKRKG
Subcellular Location(s) mito 19, nucl 7
Family & Domain DBs
Amino Acid Sequences MKIPRLGLPTPMPTRLLRAPHTHTLTYNLKQHHRNNNIHIGFLRLLTLFRAINISINIDVAKECPREENTRRRRRRRRRKRKRKGTQGYPL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.38
2 0.37
3 0.38
4 0.34
5 0.37
6 0.41
7 0.47
8 0.51
9 0.46
10 0.42
11 0.43
12 0.45
13 0.43
14 0.42
15 0.38
16 0.4
17 0.46
18 0.54
19 0.57
20 0.6
21 0.61
22 0.6
23 0.65
24 0.6
25 0.53
26 0.45
27 0.37
28 0.29
29 0.23
30 0.19
31 0.09
32 0.09
33 0.08
34 0.1
35 0.07
36 0.06
37 0.08
38 0.07
39 0.08
40 0.09
41 0.1
42 0.08
43 0.09
44 0.08
45 0.07
46 0.07
47 0.07
48 0.11
49 0.11
50 0.11
51 0.15
52 0.19
53 0.27
54 0.35
55 0.44
56 0.52
57 0.62
58 0.72
59 0.8
60 0.88
61 0.91
62 0.95
63 0.96
64 0.96
65 0.97
66 0.98
67 0.98
68 0.98
69 0.98
70 0.98
71 0.97