Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2YKH8

Protein Details
Accession A0A0C2YKH8   
Localization Confidence High
Confidence Score 16.2
NoLS Segment(s)
PositionSequenceProtein Nature
31-52SPSRKIKPSTVPSQRRKRQRDDHydrophilic
59-85QAERKRKVEVKNQKTRKEKPYELRQEGBasic
NLS Segment(s)
PositionSequence
44-49QRRKRQ
62-75RKRKVEVKNQKTRK
Subcellular Location(s) nucl 13.5, mito 11, cyto_nucl 8
Family & Domain DBs
Amino Acid Sequences MVPPTLSSRRVHDTRIALPSPANSTSCPAPSPSRKIKPSTVPSQRRKRQRDDGHATDNQAERKRKVEVKNQKTRKEKPYELRQEGFSGFKLEDGYVVALFLFDCL
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.45
2 0.5
3 0.46
4 0.38
5 0.36
6 0.35
7 0.32
8 0.29
9 0.24
10 0.18
11 0.2
12 0.21
13 0.21
14 0.2
15 0.19
16 0.24
17 0.29
18 0.37
19 0.43
20 0.5
21 0.53
22 0.57
23 0.6
24 0.61
25 0.62
26 0.64
27 0.65
28 0.67
29 0.72
30 0.79
31 0.8
32 0.81
33 0.81
34 0.79
35 0.79
36 0.78
37 0.79
38 0.76
39 0.74
40 0.69
41 0.64
42 0.56
43 0.49
44 0.42
45 0.37
46 0.35
47 0.33
48 0.28
49 0.3
50 0.34
51 0.38
52 0.42
53 0.48
54 0.53
55 0.6
56 0.69
57 0.76
58 0.8
59 0.82
60 0.84
61 0.83
62 0.81
63 0.79
64 0.78
65 0.81
66 0.82
67 0.8
68 0.74
69 0.66
70 0.6
71 0.53
72 0.45
73 0.35
74 0.26
75 0.19
76 0.18
77 0.17
78 0.14
79 0.13
80 0.12
81 0.13
82 0.1
83 0.1
84 0.09
85 0.07