Proteins with Predicted NoLSs

Proteins containing predicted nucleolar localization signals available in the database.

A0A0C2XA07

Protein Details
Accession A0A0C2XA07    Localization Confidence Medium Confidence Score 10.4
NoLS Segment(s)
PositionSequenceProtein Nature
195-225TSEAHRSRKNETPKKSQRPRRIASSKPSRMDHydrophilic
NLS Segment(s)
PositionSequence
200-218RSRKNETPKKSQRPRRIAS
Subcellular Location(s) mito 14.5, mito_nucl 13.333, nucl 11, cyto_nucl 6.333
Family & Domain DBs
Amino Acid Sequences MGPMIAPYLPLITNRISFTLNPPPGLPSLTPRNEFLDVREPRATPSPSSLTGSVSSLKSSGSVVFGPQKETGSQQGKGKGNLGAIEEQEVQQEPKGNDEIIALIQKPFGEPGRPGSGGYRLEEVLDWEPETLSKVTVFVKQAAEKDLDTTVSYSKQNIDKVDNICKAAYECFPLLTKYAKSWPVRDILKLHLKYTSEAHRSRKNETPKKSQRPRRIASSKPSRMDIESEDEM
FASTA Sequence
with NoLS information
AlphaFold Structure
with highlighted NoLS
NoLS Predictions per Residue
Residue Number Score
1 0.19
2 0.2
3 0.2
4 0.21
5 0.26
6 0.34
7 0.33
8 0.32
9 0.31
10 0.31
11 0.3
12 0.32
13 0.27
14 0.23
15 0.3
16 0.35
17 0.36
18 0.36
19 0.39
20 0.4
21 0.39
22 0.37
23 0.38
24 0.35
25 0.38
26 0.39
27 0.35
28 0.34
29 0.41
30 0.39
31 0.3
32 0.34
33 0.33
34 0.31
35 0.34
36 0.32
37 0.27
38 0.25
39 0.25
40 0.23
41 0.19
42 0.17
43 0.14
44 0.13
45 0.12
46 0.11
47 0.11
48 0.09
49 0.09
50 0.11
51 0.17
52 0.17
53 0.2
54 0.2
55 0.2
56 0.19
57 0.21
58 0.27
59 0.25
60 0.27
61 0.29
62 0.36
63 0.38
64 0.38
65 0.38
66 0.31
67 0.28
68 0.26
69 0.24
70 0.17
71 0.14
72 0.15
73 0.14
74 0.12
75 0.12
76 0.11
77 0.1
78 0.1
79 0.14
80 0.12
81 0.14
82 0.15
83 0.14
84 0.13
85 0.13
86 0.13
87 0.09
88 0.1
89 0.08
90 0.07
91 0.07
92 0.07
93 0.07
94 0.07
95 0.07
96 0.08
97 0.08
98 0.12
99 0.16
100 0.16
101 0.16
102 0.16
103 0.2
104 0.19
105 0.2
106 0.17
107 0.13
108 0.13
109 0.13
110 0.14
111 0.1
112 0.1
113 0.09
114 0.08
115 0.08
116 0.08
117 0.1
118 0.08
119 0.07
120 0.06
121 0.07
122 0.09
123 0.12
124 0.13
125 0.14
126 0.16
127 0.18
128 0.19
129 0.19
130 0.2
131 0.16
132 0.16
133 0.14
134 0.13
135 0.11
136 0.11
137 0.11
138 0.12
139 0.12
140 0.12
141 0.15
142 0.19
143 0.21
144 0.23
145 0.25
146 0.28
147 0.31
148 0.39
149 0.37
150 0.34
151 0.31
152 0.29
153 0.27
154 0.24
155 0.21
156 0.17
157 0.15
158 0.15
159 0.15
160 0.16
161 0.16
162 0.18
163 0.17
164 0.17
165 0.23
166 0.29
167 0.31
168 0.33
169 0.35
170 0.38
171 0.39
172 0.4
173 0.37
174 0.38
175 0.45
176 0.43
177 0.41
178 0.38
179 0.37
180 0.35
181 0.38
182 0.39
183 0.37
184 0.42
185 0.49
186 0.53
187 0.55
188 0.59
189 0.63
190 0.65
191 0.67
192 0.69
193 0.73
194 0.75
195 0.83
196 0.88
197 0.9
198 0.9
199 0.9
200 0.89
201 0.89
202 0.86
203 0.83
204 0.83
205 0.84
206 0.82
207 0.76
208 0.74
209 0.66
210 0.59
211 0.55
212 0.48